From PneumoWiki
Revision as of 18:02, 20 January 2022 by Robot (talk | contribs) (Created page with "<protect> <pneumodatabase>annotation</pneumodatabase> =Summary= *<pneumodatabase>organism</pneumodatabase> *<pneumodatabase>locus</pneumodatabase> *<pneumodatabase>pan locus...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
TIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: spr0536
  • symbol: spr0536
  • product: ABC transporter ATP-binding protein - glutamine, truncation
  • replicon: chromosome
  • strand: -
  • coordinates: 534635..535024
  • length: 390
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: AE007317 (534635..535024) NCBI
  • BioCyc:
  • MicrobesOnline: 133421 MicrobesOnline
  • PneumoBrowse for strain D39V:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGCTTTAGTAGAATTTAAAAACGTCGAAAAATATTACGGAGACTACCACGCACTCCGC
    AACATCAATCTCCGTTTTGAAAAAGGACAAGTTGTTGTCCTGCTTGGACCTTCTGGCTCT
    GGGAAGTCCACTCTTATCCGTACGATCAATGGTTTAGAGGCTGTTGACAAAGGAAGTCTC
    CTAGTCAATGGGCACCAAGTTGCTGGTGCCAGCCAGAAAGATTTGGTACCTCTTCGCAAG
    GAAGTCGGCATGGTTTTTCAACATTTTAACCTTTATCCACACAAAACGGTGTTAGAAAAC
    GTGACACTTGCGCCCATTAAAGTTCTAGGAATTGATAAAAAAGAAGCTGAAAAAACCGCC
    CAAAAATATCTGGAATTTGTAAATATGTGA
    60
    120
    180
    240
    300
    360
    390

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: spr0536
  • symbol: spr0536
  • description: ABC transporter ATP-binding protein - glutamine, truncation
  • length: 129
  • theoretical pI: 9.83807
  • theoretical MW: 14367.6
  • GRAVY: -0.131008

Function[edit | edit source]

  • TIGRFAM:
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 119.1)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 106.6)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 105.5)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 101.3)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 100.9)
    and 80 more
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 94.1)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 92.6)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 91.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 91.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 91.3)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 87.3)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 85.9)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 85.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 79.3)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 75.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 71.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 70)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 69.7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 68.1)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 67.7)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 65.2)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 64.5)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 64.2)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 64.2)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 62.7)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 62.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 61.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 60.2)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 57.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 57.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 56.4)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 56.2)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 56.2)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 54.8)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 54.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 54.7)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 54.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 54.1)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 53.3)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 53)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 50.6)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 50.6)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 50.1)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 50)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 50)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 47)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 47)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 45.4)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 44.3)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 43.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 43.2)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 42.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 39.7)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 39.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 39.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 39.3)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 39.3)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 38.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 37.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 36.5)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 36.5)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 36.5)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 30.7)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 30.1)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 29.8)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 29.4)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 22.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 20.4)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 18)
    Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 17.3)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 16.8)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 16.5)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 15.7)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 15.1)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 14.9)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 13.6)
    Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 13.5)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.4)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 12.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle protein (TIGR00959; HMM-score: 12.1)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 11.9)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 11.7)
    Cellular processes Cellular processes Other gas vesicle protein GvpN (TIGR02640; HMM-score: 11.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EccCb (TIGR03925; HMM-score: 11.2)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions conjugative transfer ATPase, PFL_4706 family (TIGR03744; HMM-score: 9.9)
  • TheSEED  :
    • Aspartate/glutamate ABC transporter, ATP-binding protein PebC
    Stress Response Acid stress Glutamate transporter involved in acid tolerance in Streptococcus  Glutamate transport ATP-binding protein
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 75.9)
    and 38 more
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 24)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 23.8)
    AAA_23; AAA domain (PF13476; HMM-score: 22.7)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 20.8)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 20.2)
    AAA_30; AAA domain (PF13604; HMM-score: 18.5)
    AAA_22; AAA domain (PF13401; HMM-score: 17.6)
    AAA_10; AAA-like domain (PF12846; HMM-score: 17.1)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17)
    DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 16.5)
    AAA_33; AAA domain (PF13671; HMM-score: 16.5)
    AAA_18; AAA domain (PF13238; HMM-score: 16.2)
    AAA_24; AAA domain (PF13479; HMM-score: 15.8)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 15)
    NACHT; NACHT domain (PF05729; HMM-score: 15)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 14.9)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 14.8)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 14.7)
    AAA_PrkA; PrkA AAA domain (PF08298; HMM-score: 14.6)
    Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.1)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.8)
    G-alpha; G-protein alpha subunit (PF00503; HMM-score: 13.7)
    AAA_13; AAA domain (PF13166; HMM-score: 13.4)
    SH3 (CL0010) SH3_2; Variant SH3 domain (PF07653; HMM-score: 13.3)
    P-loop_NTPase (CL0023) SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 12.9)
    DAP3; Mitochondrial ribosomal death-associated protein 3 (PF10236; HMM-score: 12.9)
    AAA_28; AAA domain (PF13521; HMM-score: 12.9)
    IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 12.8)
    PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 12.7)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.5)
    AAA_7; P-loop containing dynein motor region (PF12775; HMM-score: 12.5)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 12.4)
    Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 12.3)
    AAA_25; AAA domain (PF13481; HMM-score: 12.3)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 12.1)
    AAA_19; AAA domain (PF13245; HMM-score: 12.1)
    PhoH; PhoH-like protein (PF02562; HMM-score: 12)
    DUF815; Protein of unknown function (DUF815) (PF05673; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008682
    • TAT(Tat/SPI): 0.000577
    • LIPO(Sec/SPII): 0.000543
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MALVEFKNVEKYYGDYHALRNINLRFEKGQVVVLLGPSGSGKSTLIRTINGLEAVDKGSLLVNGHQVAGASQKDLVPLRKEVGMVFQHFNLYPHKTVLENVTLAPIKVLGIDKKEAEKTAQKYLEFVNM

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Expression data[edit | edit source]

  • PneumoExpress for strain D39V:

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]