PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae CGSP14
- locus tag: SPCG_1299 [new locus tag: SPCG_RS06715 ]
- pan locus tag?: PNEUPAN002401000
- symbol: SPCG_1299
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPCG_1299 [new locus tag: SPCG_RS06715 ]
- symbol: SPCG_1299
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1284525..1284758
- length: 234
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001033 (1284525..1284758) NCBI
- BioCyc: see SPCG_RS06715
- MicrobesOnline: 5760633 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACCATAATCGAACGCTTAGAAGAAAAGGTCACTAGGCAAGAGAGTAAGGTAGCAAGA
GAAACAGAAAAACTAGCTGCTTACAAAGAGCAACTAGAGACAGCGATGTTTGCGACGTTC
AAAAGGCGTCAAAGCATTAGTCACATGAGTTTTGAAGAAGCTCTTGACCATGCCTTTGGT
AAAGAAAGACAATTCGATGATTCTGAATTTAGAAAGGATGAAATGAGTGAATGA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPCG_1299 [new locus tag: SPCG_RS06715 ]
- symbol: SPCG_1299
- description: hypothetical protein
- length: 77
- theoretical pI: 4.96094
- theoretical MW: 9207.25
- GRAVY: -1.01429
⊟Function[edit | edit source]
- TIGRFAM: Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 11.8)
- TheSEED :
- hypothetical protein
- ⊞PFAM: no clan defined DUF5965; Family of unknown function (DUF5965) (PF19390; HMM-score: 97)and 3 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACB90551 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTIIERLEEKVTRQESKVARETEKLAAYKEQLETAMFATFKRRQSISHMSFEEALDHAFGKERQFDDSEFRKDEMSE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: