From PneumoWiki
Jump to navigation Jump to search
PangenomeTIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BM6001
serotype 19F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7465
serotype 1
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
  • symbol: SPAP_1865
  • product: ABC-type enterochelin transport system, ATPase component
  • replicon: chromosome
  • strand: +
  • coordinates: 1757369..1758121
  • length: 753
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGAAACTGGAAAACATTGACAAATCCATTCAAAAACAGGATATTTTGCAAGGCATTTCG
    CTTGAAGTCAGTCCTCAAAAACTGACAGCCTTTATTGGTCCAAATGGTGCTGGAAAATCG
    ACTCTCCTCTCCATCATGAGCAGACTAACCAAGAAAGATCAGGGAGTTCTCAGTATCAAA
    GGACGTGAAATCGAGAGCTGGAATTCGCAAGAACTGGCCCAAGAACTAACCATCCTAAAA
    CAGAAAATCAATTACCAAGCCAAATTGACTGTTGAAGAACTGGTCAGTTTTGGACGTTTT
    CCCTACAGCCGAGGTCGACTTAGATCAGAAGACTGGGAAAAAATCCGAGAAACTCTGAAC
    TATTTGGAACTGACCAACTTAAAAGACCGCTACATCAATAGCCTGTCAGGGGGGCAACTC
    CAGCGCGTCTTTATCGCTATGGTACTGGCCCAGGATACGGACTTTATCTTGCTGGACGAA
    CCACTCAACAATCTCGATATCAAGCAAAGCGTCAGCATGATGCAGATTCTTCGACGACTG
    GTGGAGGAACTCGGCAAGACCATTATCATCGTCCTCCACGATATCAACATGGCCAGTCAG
    TATGCAGATGAAATTGTCGCCTTCAAGGACGGCCAGGTCTTTAGCAAGGGAAGAACCGAT
    CAAATCATGCAGGCTGACCTGCTCAGTCAACTTTATGAGATTCCCATCACGCTAGCTGAT
    ATCAATGACAAAAAGATCTGTATCTATAGCTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    753

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
  • symbol: SPAP_1865
  • description: ABC-type enterochelin transport system, ATPase component
  • length: 250
  • theoretical pI: 5.48541
  • theoretical MW: 28499.8
  • GRAVY: -0.2052

Function[edit | edit source]

  • TIGRFAM:
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 176.1)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 154.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 141.2)
    and 75 more
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 138.1)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 137.4)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 131.5)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 123.7)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 123.7)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 121.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 119.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 117.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 116.4)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 114)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 113.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 111.6)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 111.6)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 111.6)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 110.4)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 109.1)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 108.3)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 108.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 107.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 106.7)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 104.8)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 104.3)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 103.8)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 100.8)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 98.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 97.2)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 95.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 95.5)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 94.6)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 94.1)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 90.5)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 90.2)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 90.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 87.7)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 87.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 86)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.2)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 83.5)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 83.5)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 82.5)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 81.6)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.7)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.7)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 78.5)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 73.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 73.1)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 69.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 69.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 69)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 66.2)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 63.2)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 61.3)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 61)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 58)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 56.5)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.2)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 47.5)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 44.2)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 39.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 27.7)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 27.7)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 23.2)
    flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 18.3)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 17.7)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 15.9)
    Metabolism Energy metabolism ATP-proton motive force interconversion ATPase, FliI/YscN family (TIGR01026; EC 3.6.3.14; HMM-score: 15.7)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 15)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 12.1)
    Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 10.8)
  • TheSEED  :
    • Iron compound ABC uptake transporter ATP-binding protein PiuD
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 108.7)
    and 20 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 42.4)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 32.9)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 27.7)
    AAA_23; AAA domain (PF13476; HMM-score: 24.2)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 21.4)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.4)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 20.9)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.1)
    ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 15.9)
    AAA_22; AAA domain (PF13401; HMM-score: 15.9)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 15.7)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 15.3)
    AAA_30; AAA domain (PF13604; HMM-score: 15)
    NTPase_1; NTPase (PF03266; HMM-score: 14.8)
    AAA_27; AAA domain (PF13514; HMM-score: 14.6)
    AAA_24; AAA domain (PF13479; HMM-score: 13.7)
    AAA_28; AAA domain (PF13521; HMM-score: 13.5)
    AAA_33; AAA domain (PF13671; HMM-score: 13.1)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 12.4)
    AAA_25; AAA domain (PF13481; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.04
    • Cytoplasmic Membrane Score: 9.96
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.3399
    • Cytoplasmic Membrane Score: 0.6534
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0065
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008825
    • TAT(Tat/SPI): 0.001167
    • LIPO(Sec/SPII): 0.00095
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: ADM85448 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKLENIDKSIQKQDILQGISLEVSPQKLTAFIGPNGAGKSTLLSIMSRLTKKDQGVLSIKGREIESWNSQELAQELTILKQKINYQAKLTVEELVSFGRFPYSRGRLRSEDWEKIRETLNYLELTNLKDRYINSLSGGQLQRVFIAMVLAQDTDFILLDEPLNNLDIKQSVSMMQILRRLVEELGKTIIIVLHDINMASQYADEIVAFKDGQVFSKGRTDQIMQADLLSQLYEIPITLADINDKKICIYS

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Expression data[edit | edit source]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

NCBI: 17-JAN-2018

Summary[edit | edit source]

  • organism: Streptococcus pneumoniae AP200
  • locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
  • pan locus tag?: PNEUPAN003393000
  • symbol: SPAP_1865
  • pan gene symbol?: piuD
  • synonym:
  • product: ABC-type enterochelin transport system, ATPase component

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
  • symbol: SPAP_1865
  • product: ABC-type enterochelin transport system, ATPase component
  • replicon: chromosome
  • strand: +
  • coordinates: 1757369..1758121
  • length: 753
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGAAACTGGAAAACATTGACAAATCCATTCAAAAACAGGATATTTTGCAAGGCATTTCG
    CTTGAAGTCAGTCCTCAAAAACTGACAGCCTTTATTGGTCCAAATGGTGCTGGAAAATCG
    ACTCTCCTCTCCATCATGAGCAGACTAACCAAGAAAGATCAGGGAGTTCTCAGTATCAAA
    GGACGTGAAATCGAGAGCTGGAATTCGCAAGAACTGGCCCAAGAACTAACCATCCTAAAA
    CAGAAAATCAATTACCAAGCCAAATTGACTGTTGAAGAACTGGTCAGTTTTGGACGTTTT
    CCCTACAGCCGAGGTCGACTTAGATCAGAAGACTGGGAAAAAATCCGAGAAACTCTGAAC
    TATTTGGAACTGACCAACTTAAAAGACCGCTACATCAATAGCCTGTCAGGGGGGCAACTC
    CAGCGCGTCTTTATCGCTATGGTACTGGCCCAGGATACGGACTTTATCTTGCTGGACGAA
    CCACTCAACAATCTCGATATCAAGCAAAGCGTCAGCATGATGCAGATTCTTCGACGACTG
    GTGGAGGAACTCGGCAAGACCATTATCATCGTCCTCCACGATATCAACATGGCCAGTCAG
    TATGCAGATGAAATTGTCGCCTTCAAGGACGGCCAGGTCTTTAGCAAGGGAAGAACCGAT
    CAAATCATGCAGGCTGACCTGCTCAGTCAACTTTATGAGATTCCCATCACGCTAGCTGAT
    ATCAATGACAAAAAGATCTGTATCTATAGCTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    753

This data comes from external databases and cannot be edited.

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
  • symbol: SPAP_1865
  • description: ABC-type enterochelin transport system, ATPase component
  • length: 250
  • theoretical pI: 5.48541
  • theoretical MW: 28499.8
  • GRAVY: -0.2052

Function[edit | edit source]

  • TIGRFAM:
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 176.1)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 154.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 141.2)
    and 75 more
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 138.1)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 137.4)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 131.5)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 123.7)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 123.7)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 121.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 119.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 117.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 116.4)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 114)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 113.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 111.6)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 111.6)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 111.6)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 110.4)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 109.1)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 108.3)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 108.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 107.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 106.7)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 104.8)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 104.3)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 103.8)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 100.8)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 98.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 97.2)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 95.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 95.5)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 94.6)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 94.1)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 90.5)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 90.2)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 90.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 87.7)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 87.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 86)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.2)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 83.5)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 83.5)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 82.5)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 81.6)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.7)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.7)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 78.5)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 73.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 73.1)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 69.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 69.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 69)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 66.2)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 63.2)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 61.3)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 61)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 58)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 56.5)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.2)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 47.5)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 44.2)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 39.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 27.7)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 27.7)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 23.2)
    flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 18.3)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 17.7)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 15.9)
    Metabolism Energy metabolism ATP-proton motive force interconversion ATPase, FliI/YscN family (TIGR01026; EC 3.6.3.14; HMM-score: 15.7)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 15)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 12.1)
    Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 10.8)
  • TheSEED  :
    • Iron compound ABC uptake transporter ATP-binding protein PiuD
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 108.7)
    and 20 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 42.4)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 32.9)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 27.7)
    AAA_23; AAA domain (PF13476; HMM-score: 24.2)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 21.4)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.4)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 20.9)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.1)
    ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 15.9)
    AAA_22; AAA domain (PF13401; HMM-score: 15.9)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 15.7)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 15.3)
    AAA_30; AAA domain (PF13604; HMM-score: 15)
    NTPase_1; NTPase (PF03266; HMM-score: 14.8)
    AAA_27; AAA domain (PF13514; HMM-score: 14.6)
    AAA_24; AAA domain (PF13479; HMM-score: 13.7)
    AAA_28; AAA domain (PF13521; HMM-score: 13.5)
    AAA_33; AAA domain (PF13671; HMM-score: 13.1)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 12.4)
    AAA_25; AAA domain (PF13481; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.04
    • Cytoplasmic Membrane Score: 9.96
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.3399
    • Cytoplasmic Membrane Score: 0.6534
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0065
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008825
    • TAT(Tat/SPI): 0.001167
    • LIPO(Sec/SPII): 0.00095
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: ADM85448 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKLENIDKSIQKQDILQGISLEVSPQKLTAFIGPNGAGKSTLLSIMSRLTKKDQGVLSIKGREIESWNSQELAQELTILKQKINYQAKLTVEELVSFGRFPYSRGRLRSEDWEKIRETLNYLELTNLKDRYINSLSGGQLQRVFIAMVLAQDTDFILLDEPLNNLDIKQSVSMMQILRRLVEELGKTIIIVLHDINMASQYADEIVAFKDGQVFSKGRTDQIMQADLLSQLYEIPITLADINDKKICIYS

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Expression data[edit | edit source]

Biological Material[edit | edit source]

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

Other Information[edit | edit source]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]