Links
Link important words to other wiki articles or even other websites. It will help readers understand the context.
Okay, got itYou are using a browser which is not officially supported by this editor.
⊟Summary[edit | edit source]
Contents
- organism: Streptococcus pneumoniae AP200
- locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
- pan locus tag?: PNEUPAN003393000
- symbol: SPAP_1865
- pan gene symbol?: piuD
- synonym:
- product: ABC-type enterochelin transport system, ATPase component
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
- symbol: SPAP_1865
- product: ABC-type enterochelin transport system, ATPase component
- replicon: chromosome
- strand: +
- coordinates: 1757369..1758121
- length: 753
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP002121 (1757369..1758121) NCBI
- BioCyc: see SPAP_RS09260
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1651 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721GTGAAACTGGAAAACATTGACAAATCCATTCAAAAACAGGATATTTTGCAAGGCATTTCG
CTTGAAGTCAGTCCTCAAAAACTGACAGCCTTTATTGGTCCAAATGGTGCTGGAAAATCG
ACTCTCCTCTCCATCATGAGCAGACTAACCAAGAAAGATCAGGGAGTTCTCAGTATCAAA
GGACGTGAAATCGAGAGCTGGAATTCGCAAGAACTGGCCCAAGAACTAACCATCCTAAAA
CAGAAAATCAATTACCAAGCCAAATTGACTGTTGAAGAACTGGTCAGTTTTGGACGTTTT
CCCTACAGCCGAGGTCGACTTAGATCAGAAGACTGGGAAAAAATCCGAGAAACTCTGAAC
TATTTGGAACTGACCAACTTAAAAGACCGCTACATCAATAGCCTGTCAGGGGGGCAACTC
CAGCGCGTCTTTATCGCTATGGTACTGGCCCAGGATACGGACTTTATCTTGCTGGACGAA
CCACTCAACAATCTCGATATCAAGCAAAGCGTCAGCATGATGCAGATTCTTCGACGACTG
GTGGAGGAACTCGGCAAGACCATTATCATCGTCCTCCACGATATCAACATGGCCAGTCAG
TATGCAGATGAAATTGTCGCCTTCAAGGACGGCCAGGTCTTTAGCAAGGGAAGAACCGAT
CAAATCATGCAGGCTGACCTGCTCAGTCAACTTTATGAGATTCCCATCACGCTAGCTGAT
ATCAATGACAAAAAGATCTGTATCTATAGCTAG60
120
180
240
300
360
420
480
540
600
660
720
753
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
- symbol: SPAP_1865
- description: ABC-type enterochelin transport system, ATPase component
- length: 250
- theoretical pI: 5.48541
- theoretical MW: 28499.8
- GRAVY: -0.2052
⊟Function[edit | edit source]
- ⊞⊞TIGRFAM: proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 176.1)Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 154.3)Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 141.2)and 75 moreMetabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 138.1)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 137.4)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 131.5)Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 123.7)Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 123.7)Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 121.9)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 119.6)Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 117.7)Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 116.4)Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 114)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 113.4)Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 111.6)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 111.6)Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 111.6)Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 110.4)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 109.1)Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 108.3)Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 108.1)Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 107.7)Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 106.7)Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 104.8)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 104.3)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 103.8)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 100.8)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 98.4)Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 97.2)Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 95.5)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 95.5)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 94.6)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 94.1)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 90.5)Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 90.2)Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 90.2)Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 87.7)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 87.6)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 86)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.2)Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.2)Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 83.5)Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 83.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 82.5)Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 81.6)Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.7)Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.7)Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 78.5)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.1)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.1)Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 73.5)Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 73.1)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 69.5)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 69.5)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 69)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 66.2)Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 63.2)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 61.3)Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 61)Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 58)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 56.5)Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.2)Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 47.5)Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 44.2)Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 39.6)Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 27.7)Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 27.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 23.2)flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 18.3)Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 17.7)Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 15.9)Metabolism Energy metabolism ATP-proton motive force interconversion ATPase, FliI/YscN family (TIGR01026; EC 3.6.3.14; HMM-score: 15.7)Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 15)Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 12.1)Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 10.8)
- TheSEED :
- Iron compound ABC uptake transporter ATP-binding protein PiuD
- ⊞⊞PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 108.7)and 20 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 42.4)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 32.9)AAA_15; AAA ATPase domain (PF13175; HMM-score: 27.7)AAA_23; AAA domain (PF13476; HMM-score: 24.2)AAA_16; AAA ATPase domain (PF13191; HMM-score: 21.4)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.4)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 20.9)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.1)ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 15.9)AAA_22; AAA domain (PF13401; HMM-score: 15.9)RNA_helicase; RNA helicase (PF00910; HMM-score: 15.7)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 15.3)AAA_30; AAA domain (PF13604; HMM-score: 15)NTPase_1; NTPase (PF03266; HMM-score: 14.8)AAA_27; AAA domain (PF13514; HMM-score: 14.6)AAA_24; AAA domain (PF13479; HMM-score: 13.7)AAA_28; AAA domain (PF13521; HMM-score: 13.5)AAA_33; AAA domain (PF13671; HMM-score: 13.1)ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 12.4)AAA_25; AAA domain (PF13481; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- ⊞⊞PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- ⊞⊞DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.3399
- Cytoplasmic Membrane Score: 0.6534
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0065
- ⊞⊞SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008825
- TAT(Tat/SPI): 0.001167
- LIPO(Sec/SPII): 0.00095
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADM85448 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKLENIDKSIQKQDILQGISLEVSPQKLTAFIGPNGAGKSTLLSIMSRLTKKDQGVLSIKGREIESWNSQELAQELTILKQKINYQAKLTVEELVSFGRFPYSRGRLRSEDWEKIRETLNYLELTNLKDRYINSLSGGQLQRVFIAMVLAQDTDFILLDEPLNNLDIKQSVSMMQILRRLVEELGKTIIIVLHDINMASQYADEIVAFKDGQVFSKGRTDQIMQADLLSQLYEIPITLADINDKKICIYS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1651 PneumoExpress
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae AP200
- locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
- pan locus tag?: PNEUPAN003393000
- symbol: SPAP_1865
- pan gene symbol?: piuD
- synonym:
- product: ABC-type enterochelin transport system, ATPase component
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
- symbol: SPAP_1865
- product: ABC-type enterochelin transport system, ATPase component
- replicon: chromosome
- strand: +
- coordinates: 1757369..1758121
- length: 753
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP002121 (1757369..1758121) NCBI
- BioCyc: see SPAP_RS09260
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1651 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit
]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721GTGAAACTGGAAAACATTGACAAATCCATTCAAAAACAGGATATTTTGCAAGGCATTTCG
CTTGAAGTCAGTCCTCAAAAACTGACAGCCTTTATTGGTCCAAATGGTGCTGGAAAATCG
ACTCTCCTCTCCATCATGAGCAGACTAACCAAGAAAGATCAGGGAGTTCTCAGTATCAAA
GGACGTGAAATCGAGAGCTGGAATTCGCAAGAACTGGCCCAAGAACTAACCATCCTAAAA
CAGAAAATCAATTACCAAGCCAAATTGACTGTTGAAGAACTGGTCAGTTTTGGACGTTTT
CCCTACAGCCGAGGTCGACTTAGATCAGAAGACTGGGAAAAAATCCGAGAAACTCTGAAC
TATTTGGAACTGACCAACTTAAAAGACCGCTACATCAATAGCCTGTCAGGGGGGCAACTC
CAGCGCGTCTTTATCGCTATGGTACTGGCCCAGGATACGGACTTTATCTTGCTGGACGAA
CCACTCAACAATCTCGATATCAAGCAAAGCGTCAGCATGATGCAGATTCTTCGACGACTG
GTGGAGGAACTCGGCAAGACCATTATCATCGTCCTCCACGATATCAACATGGCCAGTCAG
TATGCAGATGAAATTGTCGCCTTCAAGGACGGCCAGGTCTTTAGCAAGGGAAGAACCGAT
CAAATCATGCAGGCTGACCTGCTCAGTCAACTTTATGAGATTCCCATCACGCTAGCTGAT
ATCAATGACAAAAAGATCTGTATCTATAGCTAG60
120
180
240
300
360
420
480
540
600
660
720
753
This data comes from external databases and cannot be edited.
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPAP_1865 [new locus tag: SPAP_RS09260 ]
- symbol: SPAP_1865
- description: ABC-type enterochelin transport system, ATPase component
- length: 250
- theoretical pI: 5.48541
- theoretical MW: 28499.8
- GRAVY: -0.2052
⊟Function[edit | edit source]
- ⊞TIGRFAM: proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 176.1)Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 154.3)Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 141.2)and 75 moreMetabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 138.1)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 137.4)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 131.5)Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 123.7)Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 123.7)Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 121.9)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 119.6)Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 117.7)Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 116.4)Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 114)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 113.4)Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 111.6)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 111.6)Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 111.6)Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 110.4)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 109.1)Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 108.3)Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 108.1)Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 107.7)Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 106.7)Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 104.8)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 104.3)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 103.8)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 100.8)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 98.4)Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 97.2)Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 95.5)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 95.5)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 94.6)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 94.1)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 90.5)Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 90.2)Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 90.2)Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 87.7)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 87.6)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 86)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.2)Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.2)Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 83.5)Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 83.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 82.5)Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 81.6)Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.7)Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 79.7)Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 78.5)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.1)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 74.1)Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 73.5)Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 73.1)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 69.5)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 69.5)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 69)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 66.2)Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 63.2)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 61.3)Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 61)Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 58)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 56.5)Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.2)Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 47.5)Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 44.2)Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 39.6)Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 27.7)Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 27.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 23.2)flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 18.3)Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 17.7)Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 15.9)Metabolism Energy metabolism ATP-proton motive force interconversion ATPase, FliI/YscN family (TIGR01026; EC 3.6.3.14; HMM-score: 15.7)Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 15)Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 12.1)Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 10.8)
- TheSEED :
- Iron compound ABC uptake transporter ATP-binding protein PiuD
- ⊞PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 108.7)and 20 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 42.4)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 32.9)AAA_15; AAA ATPase domain (PF13175; HMM-score: 27.7)AAA_23; AAA domain (PF13476; HMM-score: 24.2)AAA_16; AAA ATPase domain (PF13191; HMM-score: 21.4)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.4)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 20.9)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.1)ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 15.9)AAA_22; AAA domain (PF13401; HMM-score: 15.9)RNA_helicase; RNA helicase (PF00910; HMM-score: 15.7)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 15.3)AAA_30; AAA domain (PF13604; HMM-score: 15)NTPase_1; NTPase (PF03266; HMM-score: 14.8)AAA_27; AAA domain (PF13514; HMM-score: 14.6)AAA_24; AAA domain (PF13479; HMM-score: 13.7)AAA_28; AAA domain (PF13521; HMM-score: 13.5)AAA_33; AAA domain (PF13671; HMM-score: 13.1)ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 12.4)AAA_25; AAA domain (PF13481; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- ⊞PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- ⊞DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.3399
- Cytoplasmic Membrane Score: 0.6534
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0065
- ⊞SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008825
- TAT(Tat/SPI): 0.001167
- LIPO(Sec/SPII): 0.00095
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADM85448 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKLENIDKSIQKQDILQGISLEVSPQKLTAFIGPNGAGKSTLLSIMSRLTKKDQGVLSIKGREIESWNSQELAQELTILKQKINYQAKLTVEELVSFGRFPYSRGRLRSEDWEKIRETLNYLELTNLKDRYINSLSGGQLQRVFIAMVLAQDTDFILLDEPLNNLDIKQSVSMMQILRRLVEELGKTIIIVLHDINMASQYADEIVAFKDGQVFSKGRTDQIMQADLLSQLYEIPITLADINDKKICIYS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1651 PneumoExpress
⊞Biological Material[edit | edit source]
This data comes from external databases and cannot be edited.
⊟Mutants[edit | edit source]
This data comes from external databases and cannot be edited.
⊟Expression vector[edit | edit source]
This data comes from external databases and cannot be edited.
⊟lacZ fusion[edit | edit source]
This data comes from external databases and cannot be edited.
⊟GFP fusion[edit | edit source]
This data comes from external databases and cannot be edited.
⊟two-hybrid system[edit | edit source]
This data comes from external databases and cannot be edited.
⊟FLAG-tag construct[edit | edit source]
This data comes from external databases and cannot be edited.
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.