Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae CGSP14
- locus tag: SPCG_2167 [new locus tag: SPCG_RS11460 ]
- pan locus tag?: PNEUPAN003907000
- symbol: SPCG_2167
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPCG_2167 [new locus tag: SPCG_RS11460 ]
- symbol: SPCG_2167
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2169213..2169503
- length: 291
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001033 (2169213..2169503) NCBI
- BioCyc: see SPCG_RS11460
- MicrobesOnline: 5761556 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_2027 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAGCAAGCATTGCCTTGCAAGTTTTACCCCTAGCACAGGGGATTGATCGGATAGCT
GTTATTGATCAGGTCATTGCTTATCTGCAAACTCAAGAAGTGACGATGGTAGTGACACCA
TTTGAAACGGTCTTGGAAGGGGAGTTTGATGAGCTTATGCGCATTCTAAAAGAAGCGCTG
GAAGTGGCAGGGCAGGAGGCAGACAATGTCTTTGCCAATGTCAAAATAAATGTAGGAGAG
ATTTTAAGTATTGATGAGAAACTTGAAAAGTATACTGAGACGACACATTAG60
120
180
240
291
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPCG_2167 [new locus tag: SPCG_RS11460 ]
- symbol: SPCG_2167
- description: hypothetical protein
- length: 96
- theoretical pI: 4.01801
- theoretical MW: 10690.2
- GRAVY: 0.191667
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General uncharacterized protein, MTH1187 family (TIGR00106; HMM-score: 28.2)
- TheSEED :
- Cytoplasmic thiamin-binding protein associated with thiamin ABC transporter
- ⊞PFAM: MTH1187-YkoF (CL0360) Thiamine_BP; Thiamine-binding protein (PF01910; HMM-score: 54)and 2 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACB91419 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKASIALQVLPLAQGIDRIAVIDQVIAYLQTQEVTMVVTPFETVLEGEFDELMRILKEALEVAGQEADNVFANVKINVGEILSIDEKLEKYTETTH
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2027 PneumoExpress