Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 25-OCT-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TCH8431/19A
- locus tag: HMPREF0837_RS03850 [old locus tag: HMPREF0837_10796 ]
- pan locus tag?: PNEUPAN001407000
- symbol: glnR
- pan gene symbol?: glnR
- synonym:
- product: transcriptional repressor GlnR
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF0837_RS03850 [old locus tag: HMPREF0837_10796 ]
- symbol: glnR
- product: transcriptional repressor GlnR
- replicon: chromosome
- strand: +
- coordinates: 732298..732654
- length: 357
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_014251 (732298..732654) NCBI
- BioCyc: HMPREF0837_RS03850 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0447 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAGGAAAAAGAATTTCGCCGAAATATGGCTGTTTTTCCTATCGGCAGTGTTATGAAG
TTGACCGATTTATCGGCGCGTCAGATTCGTTATTATGAAGATCAAGAGTTGATCAAGCCC
GATCGAAACGAAGGAAATCGTCGCATGTATTCCTTGAATGACATGGATCGTCTGCTTGAA
ATCAAAGATTATATCTCTGAAGGTTATAATATCGCTGCCATTAAGAAAAAATATGCTGAA
CGTGAAGCGAAATCCAAGAAAGCGGTTAGTCAGACTGAAGTACGTCGTGCACTTCACAAT
GAACTCCTCCAACAGGGGCGTTTTGCTTCAGTACAGTCACCTTTTGGTCGCGGTTAG60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF0837_RS03850 [old locus tag: HMPREF0837_10796 ]
- symbol: GlnR
- description: transcriptional repressor GlnR
- length: 118
- theoretical pI: 10.2522
- theoretical MW: 13861.8
- GRAVY: -0.892373
⊟Function[edit | edit source]
- ⊞TIGRFAM: Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 37.6)Regulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 33.1)and 6 more
- TheSEED: see HMPREF0837_10796
- ⊞PFAM: HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 64.7)and 2 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by GlnR*, TF important in Nitrogen assimilation: in TIGR4
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000659547 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNEGNRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQQGRFASVQSPFGRG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0447 PneumoExpress
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Tomas G Kloosterman, Wouter T Hendriksen, Jetta J E Bijlsma, Hester J Bootsma, Sacha A F T van Hijum, Jan Kok, Peter W M Hermans, Oscar P Kuipers
Regulation of glutamine and glutamate metabolism by GlnR and GlnA in Streptococcus pneumoniae.
J Biol Chem: 2006, 281(35);25097-109
[PubMed:16787930] [WorldCat.org] [DOI] (P p)Wouter T Hendriksen, Tomas G Kloosterman, Hester J Bootsma, Silvia Estevão, Ronald de Groot, Oscar P Kuipers, Peter W M Hermans
Site-specific contributions of glutamine-dependent regulator GlnR and GlnR-regulated genes to virulence of Streptococcus pneumoniae.
Infect Immun: 2008, 76(3);1230-8
[PubMed:18174343] [WorldCat.org] [DOI] (I p)