⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae A66
- locus tag: A66_RS09920 [old locus tag: A66_01979 ]
- pan locus tag?: PNEUPAN003867000
- symbol: adcR
- pan gene symbol?: adcR
- synonym:
- product: zinc-dependent transcriptional regulator AdcR
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: A66_RS09920 [old locus tag: A66_01979 ]
- symbol: adcR
- product: zinc-dependent transcriptional regulator AdcR
- replicon: chromosome
- strand: -
- coordinates: 1892243..1892683
- length: 441
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_LN847353 (1892243..1892683) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_2000 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGACAGCTAGCAAAGGATATCGATGCTTTTTTGAATGAGGTGATTTTGCAGGCGGAA
AATCAGCATGAAATCCTAATAGGTCATTGCACTAGCGAGGTGGCCCTGACCAATACTCAG
GAGCATATCCTTATGCTCTTGTCAGAGGAATCTTTAACAAATTCAGAATTGGCCCGTCGT
CTCAATGTCAGTCAGGCGGCAGTTACCAAGGCCATTAAGTCTTTGGTCAAGGAAGGGATG
TTGGAAACATCTAAAGATTCTAAAGATGCGCGTGTGATTTTTTATCAGTTGACTGACTTG
GCTCGTCCAATCGCTGAGGAGCACCACCATCACCATGAGCATACACTTTTAACCTATGAA
CAAGTGGCGACTCAGTTTACTCCAAATGAACAAAAAGTGATTCAGCGGTTTTTGACTGCT
TTAGTAGGAGAAATCAAATAA60
120
180
240
300
360
420
441
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: A66_RS09920 [old locus tag: A66_01979 ]
- symbol: AdcR
- description: zinc-dependent transcriptional regulator AdcR
- length: 146
- theoretical pI: 6.01688
- theoretical MW: 16606.8
- GRAVY: -0.277397
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 31.8)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 29.3)and 17 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 22.5)Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 22.5)DNA metabolism DNA replication, recombination, and repair DnaD family protein (TIGR04548; HMM-score: 21.7)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 19.7)Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 18.2)Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 18.2)Regulatory functions DNA interactions biotin operon repressor (TIGR00122; HMM-score: 17.5)EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 17)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 16.6)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 16.3)phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 15.6)mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 15.4)DNA metabolism DNA replication, recombination, and repair phage replication protein O, N-terminal domain (TIGR01610; HMM-score: 15.1)Mobile and extrachromosomal element functions Prophage functions phage replication protein O, N-terminal domain (TIGR01610; HMM-score: 15.1)RNA polymerase sigma-70 factor, TIGR02952 family (TIGR02952; HMM-score: 13.6)RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 13.5)Regulatory functions DNA interactions phenylacetic acid degradation operon negative regulatory protein PaaX (TIGR02277; HMM-score: 12.3)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 49.5)MarR_2; MarR family (PF12802; HMM-score: 41.5)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 40.5)and 45 moreHTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 33.3)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 30.5)HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 29.6)HTH_11; HTH domain (PF08279; HMM-score: 29.1)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 29)GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 24.2)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 23.7)Dimerisation2; Dimerisation domain (PF16864; HMM-score: 22.5)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 22.4)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 21.5)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 21.1)PCI; PCI domain (PF01399; HMM-score: 20.1)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 19.6)RPA_C; Replication protein A C terminal (PF08784; HMM-score: 19.1)Phage_rep_O; Bacteriophage replication protein O (PF04492; HMM-score: 19)Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 18.7)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 18.5)DUF4423; Domain of unknown function (DUF4423) (PF14394; HMM-score: 18.4)HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 17.8)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 17.6)HTH_6; Helix-turn-helix domain, rpiR family (PF01418; HMM-score: 17.4)HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 16.1)HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 16)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 15.9)HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 15.9)UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 15.4)HTH_PafC; PafC helix-turn-helix domain (PF19187; HMM-score: 15.1)SMC_Nse1; Nse1 non-SMC component of SMC5-6 complex (PF07574; HMM-score: 14.8)ESCRT-II; ESCRT-II complex subunit (PF05871; HMM-score: 14.3)PPP-I (CL0570) Pro-kuma_activ; Pro-kumamolisin, activation domain (PF09286; HMM-score: 13.9)HTH (CL0123) HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.7)PheRS_DBD1; PheRS DNA binding domain 1 (PF18552; HMM-score: 13.7)EAP30; EAP30/Vps36 family (PF04157; HMM-score: 13.6)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 13.6)HTH_3; Helix-turn-helix (PF01381; HMM-score: 13.4)DUF2582; Winged helix-turn-helix domain (DUF2582) (PF10771; HMM-score: 13.3)DprA_WH; DprA winged helix domain (PF17782; HMM-score: 13.2)PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 13.1)HTH_9; RNA polymerase III subunit RPC82 helix-turn-helix domain (PF08221; HMM-score: 13.1)TetR_C (CL0174) TetR_C_24; Tetracyclin repressor-like, C-terminal domain (PF17932; HMM-score: 13.1)HTH (CL0123) TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 13)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 12.9)PaaX; PaaX-like protein (PF07848; HMM-score: 12.8)DUF1495; Winged helix DNA-binding domain (DUF1495) (PF07381; HMM-score: 12.6)HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by AdcR, TF important in Zinc homeostasis: in D39V, TIGR4
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9958
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0034
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007991
- TAT(Tat/SPI): 0.000278
- LIPO(Sec/SPII): 0.000473
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001249309 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRQLAKDIDAFLNEVILQAENQHEILIGHCTSEVALTNTQEHILMLLSEESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDSKDARVIFYQLTDLARPIAEEHHHHHEHTLLTYEQVATQFTPNEQKVIQRFLTALVGEIK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2000 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Ekaterina M Panina, Andrey A Mironov, Mikhail S Gelfand
Comparative genomics of bacterial zinc regulons: enhanced ion transport, pathogenesis, and rearrangement of ribosomal proteins.
Proc Natl Acad Sci U S A: 2003, 100(17);9912-7
[PubMed:12904577] [WorldCat.org] [DOI] (P p)Hermes Reyes-Caballero, Alfredo J Guerra, Faith E Jacobsen, Krystyna M Kazmierczak, Darin Cowart, Uma Mahendra Kumar Koppolu, Robert A Scott, Malcolm E Winkler, David P Giedroc
The metalloregulatory zinc site in Streptococcus pneumoniae AdcR, a zinc-activated MarR family repressor.
J Mol Biol: 2010, 403(2);197-216
[PubMed:20804771] [WorldCat.org] [DOI] (I p)Sulman Shafeeq, Tomas G Kloosterman, Oscar P Kuipers
Transcriptional response of Streptococcus pneumoniae to Zn2+) limitation and the repressor/activator function of AdcR.
Metallomics: 2011, 3(6);609-18
[PubMed:21603707] [WorldCat.org] [DOI] (I p)