Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 03-SEP-2019
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ASP0581
- locus tag: ASP0581_17340 [new locus tag: EL334_RS09195 ]
- pan locus tag?: PNEUPAN003321000
- symbol: ptcB_1
- pan gene symbol?: ptcB_1
- synonym:
- product: PTS sugar transporter subunit IIB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: ASP0581_17340 [new locus tag: EL334_RS09195 ]
- symbol: ptcB_1
- product: PTS sugar transporter subunit IIB
- replicon: chromosome
- strand: -
- coordinates: 1712875..1713192
- length: 318
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AP019192 (1712875..1713192) NCBI
- BioCyc: see EL334_RS09195
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCTAAAGTAACAATTATGTTAGCATGTGCAGCAGGTATGAGTACAAGTCTGCTAGTG
ACAAAGATGCAAAAGGCAGCAGAAGATAAGGGGTTGGATGCAGAAATTTTTGCAGTTCCA
GCTCCTGAAGCAGAAGAAATTGTAGCAACAAAAGAAGTAAATGTGTTGCTTTTAGGTCCT
CAAGTTCGCTATTTACTAGGGGACTTTCAAGAAAAACTAAAAGATAGACAGATTCCTGTG
GCGGTTATTCCGATGACAGATTACGGAATGATGAATGGTTCTAAAGTTTTAGATTTAGCT
GAAAGTTTATTAGACTAA60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ASP0581_17340 [new locus tag: EL334_RS09195 ]
- symbol: PtcB_1
- description: PTS sugar transporter subunit IIB
- length: 105
- theoretical pI: 4.33227
- theoretical MW: 11324.3
- GRAVY: 0.277143
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 94.6)Signal transduction PTS PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 94.6)
- TheSEED: data available for Hungary19A-6
- PFAM: Phosphatase (CL0031) PTS_IIB; PTS system, Lactose/Cellobiose specific IIB subunit (PF02302; HMM-score: 81)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9981
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.0019
- SignalP: Signal peptide SP(Sec/SPI) length 26 aa
- SP(Sec/SPI): 0.749378
- TAT(Tat/SPI): 0.009461
- LIPO(Sec/SPII): 0.026065
- Cleavage Site: CS pos: 26-27. QKA-AE. Pr: 0.4044
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: BBG82256 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAKVTIMLACAAGMSTSLLVTKMQKAAEDKGLDAEIFAVPAPEAEEIVATKEVNVLLLGPQVRYLLGDFQEKLKDRQIPVAVIPMTDYGMMNGSKVLDLAESLLD
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]