Jump to navigation
		Jump to search
		
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 13-OCT-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NCTC7465
- locus tag: AT689_RS02540 [old locus tag: ERS445053_00508 ]
- pan locus tag?: PNEUPAN000381000
- symbol: comW
- pan gene symbol?: comW
- synonym:
- product: sigma(X)-activator ComW
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: AT689_RS02540 [old locus tag: ERS445053_00508 ]
- symbol: comW
- product: sigma(X)-activator ComW
- replicon: chromosome
- strand: -
- coordinates: 474769..475005
- length: 237
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_LN831051 (474769..475005) NCBI
- BioCyc: AT689_RS02540 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0023 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTAT
 GGTCCTACATTTGGTGATAATTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTAT
 TATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTATCGTTTACCATTATCGTGTT
 GCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA60
 120
 180
 237
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: AT689_RS02540 [old locus tag: ERS445053_00508 ]
- symbol: ComW
- description: sigma(X)-activator ComW
- length: 78
- theoretical pI: 6.77627
- theoretical MW: 9686.08
- GRAVY: -0.203846
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.5672
- Cytoplasmic Membrane Score: 0.3022
- Cell wall & surface Score: 0
- Extracellular Score: 0.1306
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.002579
- TAT(Tat/SPI): 0.000283
- LIPO(Sec/SPII): 0.001162
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000939546 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0023 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Ping Luo, Haiying Li, Donald A Morrison  
Identification of ComW as a new component in the regulation of genetic transformation in Streptococcus pneumoniae. 
Mol Microbiol: 2004, 54(1);172-83 
[PubMed:15458414]  [WorldCat.org] [DOI] (P p)