Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 13-OCT-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NCTC7465
- locus tag: AT689_RS13230 [old locus tag: ERS445053_00342 ]
- pan locus tag?: PNEUPAN000811000
- symbol: AT689_RS13230
- pan gene symbol?: bshA
- synonym:
- product: glycosyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: AT689_RS13230 [old locus tag: ERS445053_00342 ]
- symbol: AT689_RS13230
- product: glycosyltransferase
- replicon: chromosome
- strand: -
- coordinates: 328507..328791
- length: 285
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_LN831051 (328507..328791) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTGTGTTTTAGAGTCAATGTCACAAGGAACTCCGGTTTTAGCTAGTAATGTTGGCGGG
TTAAGTGAAATTATTGAACATAGGGTTGATGGATTTTTATTTGAGAAGGAAGATGTTGAG
GGAGTGTGTGCTTGTGCTAATTTTTTACTCAATGATTCTGAGTATTTGAAATATGTAGGT
GAGAATAGTAAATCAAAAATAAGAAAACATTTTTCTGTGCAAAAAATGTTTGTAGAAACC
ATGAGAGTATATGATGAATTATTAGAGAAGAGTAGTCATGGATAG60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: AT689_RS13230 [old locus tag: ERS445053_00342 ]
- symbol: AT689_RS13230
- description: glycosyltransferase
- length: 94
- theoretical pI: 4.8618
- theoretical MW: 10580
- GRAVY: -0.185106
⊟Function[edit | edit source]
- reaction: EC 2.4.-.-? ExPASy
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA (TIGR03999; EC 2.4.1.-; HMM-score: 59.9)sugar transferase, PEP-CTERM/EpsH1 system associated (TIGR03088; HMM-score: 58.1)and 9 moreEnergy metabolism Biosynthesis and degradation of polysaccharides glycogen synthase, Corynebacterium family (TIGR02149; HMM-score: 44.6)PEP-CTERM/exosortase A-associated glycosyltransferase, Daro_2409 family (TIGR04063; EC 2.4.-.-; HMM-score: 41.7)D-inositol-3-phosphate glycosyltransferase (TIGR03449; EC 2.4.1.250; HMM-score: 28.6)sucrose-phosphate synthase, putative, glycosyltransferase domain (TIGR02472; EC 2.4.1.14; HMM-score: 27.6)Energy metabolism Biosynthesis and degradation of polysaccharides sucrose synthase (TIGR02470; EC 2.4.1.13; HMM-score: 24)colanic acid biosynthesis glycosyltransferase WcaL (TIGR04005; EC 2.4.-.-; HMM-score: 21.2)glycosyltransferase, GG-Bacteroidales peptide system (TIGR04157; EC 2.4.1.-; HMM-score: 20.4)Energy metabolism Biosynthesis and degradation of polysaccharides glycogen/starch synthase, ADP-glucose type (TIGR02095; EC 2.4.1.21; HMM-score: 17.4)putative glycosyltransferase, TIGR04348 family (TIGR04348; EC 2.4.1.-; HMM-score: 12.6)
- TheSEED: data available for Hungary19A-6, TIGR4
- PFAM: GT-B (CL0113) Glycos_transf_1; Glycosyl transferases group 1 (PF00534; HMM-score: 46.2)and 2 moreGlyco_trans_1_4; Glycosyl transferases group 1 (PF13692; HMM-score: 32.1)Glyco_trans_1_2; Glycosyl transferases group 1 (PF13524; HMM-score: 27.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5429
- Cytoplasmic Membrane Score: 0.146
- Cell wall & surface Score: 0.002
- Extracellular Score: 0.3091
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011638
- TAT(Tat/SPI): 0.000761
- LIPO(Sec/SPII): 0.00491
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_016398428 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MCVLESMSQGTPVLASNVGGLSEIIEHRVDGFLFEKEDVEGVCACANFLLNDSEYLKYVGENSKSKIRKHFSVQKMFVETMRVYDELLEKSSHG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.