Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 09-DEC-2016
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SP49
- locus tag: BMJ42_00089 [new locus tag: BMJ42_RS00440 ]
- pan locus tag?: PNEUPAN000588000
- symbol: BMJ42_00089
- pan gene symbol?: —
- synonym:
- product: phage replication protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: BMJ42_00089 [new locus tag: BMJ42_RS00440 ]
- symbol: BMJ42_00089
- product: phage replication protein
- replicon: chromosome
- strand: +
- coordinates: 65940..66206
- length: 267
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP018136 (65940..66206) NCBI
- BioCyc: see BMJ42_RS00440
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGATGGTGGTGCTGGCTAATCACCCAAATTGGCAAGTCTATCCGGATGAGATAGCTAAA
CGAAAAGGTGTTAGTCGAGACACAGTTGATAGATACTTCAAAATATTAGAAAAAAATGGC
TACCTACGAATTGTTAAAAAAGGCATGGGACGTGGTAAAGGAGTTCGTGTTTTCAGATTT
TTCTCAGATGTAAAAATATCCGATTTTCAATTTGAAATCATGAAACAGAGATTGAATGAA
AGTATATCTAAGTTATCCACAGGTTAG60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: BMJ42_00089 [new locus tag: BMJ42_RS00440 ]
- symbol: BMJ42_00089
- description: phage replication protein
- length: 88
- theoretical pI: 10.8494
- theoretical MW: 10300
- GRAVY: -0.447727
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 19.6)Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 16.9)phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 15.7)and 1 moreRegulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 14.9)
- TheSEED:
- PFAM: HTH (CL0123) HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 26.8)HTH_11; HTH domain (PF08279; HMM-score: 24.3)Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 21.7)and 16 moreHTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.2)MarR; MarR family (PF01047; HMM-score: 16.9)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.6)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 16.6)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 16)MarR_2; MarR family (PF12802; HMM-score: 15.3)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 15.3)HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 14.8)DUF4423; Domain of unknown function (DUF4423) (PF14394; HMM-score: 14.3)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 13.6)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 13.4)FaeA; FaeA-like protein (PF04703; HMM-score: 13)GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 12.8)RepL; Firmicute plasmid replication protein (RepL) (PF05732; HMM-score: 12.2)Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 12.1)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9856
- Cytoplasmic Membrane Score: 0.0058
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0084
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002446
- TAT(Tat/SPI): 0.000149
- LIPO(Sec/SPII): 0.000358
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: APJ29431 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MMVVLANHPNWQVYPDEIAKRKGVSRDTVDRYFKILEKNGYLRIVKKGMGRGKGVRVFRFFSDVKISDFQFEIMKQRLNESISKLSTG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]