Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 09-DEC-2016
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SP49
- locus tag: BMJ42_01466 [new locus tag: BMJ42_RS07755 ]
- pan locus tag?: PNEUPAN002796000
- symbol: BMJ42_01466
- pan gene symbol?: atpE
- synonym:
- product: F0F1 ATP synthase subunit C
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: BMJ42_01466 [new locus tag: BMJ42_RS07755 ]
- symbol: BMJ42_01466
- product: F0F1 ATP synthase subunit C
- replicon: chromosome
- strand: -
- coordinates: 1394434..1394634
- length: 201
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: CP018136 (1394434..1394634) NCBI
- BioCyc: see BMJ42_RS07755
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1341 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATTTAACATTTTTAGGCTTATGTATTGCCTGTATGGGCGTATCTGTCGGTGAAGGT
TTATTGATGAATGGACTGTTTAAATCAGTAGCACGCCAACCAGATATGCTTTCTGAGTTT
CGTAGTTTGATGTTTTTAGGTGTTGCCTTTATTGAAGGAACTTTCTTTGTAACTCTTGTC
TTCTCATTTATTATCAAATAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: BMJ42_01466 [new locus tag: BMJ42_RS07755 ]
- symbol: BMJ42_01466
- description: F0F1 ATP synthase subunit C
- length: 66
- theoretical pI: 6.37468
- theoretical MW: 7259.77
- GRAVY: 1.12879
⊟Function[edit | edit source]
- reaction: EC 3.6.3.14? ExPASyH+-transporting two-sector ATPase ATP + H2O + H+(In) = ADP + phosphate + H+(Out)
- TIGRFAM: Energy metabolism ATP-proton motive force interconversion ATP synthase F0, C subunit (TIGR01260; EC 3.6.3.14; HMM-score: 41.5)and 1 morealternate F1F0 ATPase, F0 subunit C (TIGR03322; EC 3.6.3.-; HMM-score: 30.4)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: no clan defined ATP-synt_C; ATP synthase subunit C (PF00137; HMM-score: 31.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.030681
- TAT(Tat/SPI): 0.000439
- LIPO(Sec/SPII): 0.146322
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: APJ30762 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1341 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.