Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-MAR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SP49
- locus tag: BMJ42_RS02340 [old locus tag: BMJ42_00442 ]
- pan locus tag?: PNEUPAN001088000
- symbol: BMJ42_RS02340
- pan gene symbol?: yorfE
- synonym:
- product: helix-turn-helix transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: BMJ42_RS02340 [old locus tag: BMJ42_00442 ]
- symbol: BMJ42_RS02340
- product: helix-turn-helix transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 384562..384756
- length: 195
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP018136 (384562..384756) NCBI
- BioCyc: BMJ42_RS02340 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0303 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATCGTGTGAAAGAATTTCGCAAGGAACTAGGTATTTCCCAGCTCGAGCTCGCCAAG
GATATCGGTGTTTCGAGACAAACCATCAATATGATTGAGAACGACAAGTACAACCCAACT
CTGGAACTCTGTCTCAATCTCGCCCGCAGTCTCCAAACTGACCTCAACAGTCTCTTTTGG
GAAGATAATTTTTAA60
120
180
195
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: BMJ42_RS02340 [old locus tag: BMJ42_00442 ]
- symbol: BMJ42_RS02340
- description: helix-turn-helix transcriptional regulator
- length: 64
- theoretical pI: 4.65124
- theoretical MW: 7517.53
- GRAVY: -0.48125
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 47)and 8 moreMobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 33.1)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 33.1)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 33.1)Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 22.9)putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 21.6)Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 19.6)Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 14.6)probable regulatory domain (TIGR03879; HMM-score: 12.2)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 63.4)and 17 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 32.3)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 19.3)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 18.4)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 17.4)no clan defined Ran-binding; RanGTP-binding protein (PF05508; HMM-score: 16.5)HTH (CL0123) NUMOD1; NUMOD1 domain (PF07453; HMM-score: 16.1)Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 15.8)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 15.6)HTH_11; HTH domain (PF08279; HMM-score: 15.3)YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 15.1)CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 14.8)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 13.6)E-set (CL0159) Ig_GlcNase; Exo-beta-D-glucosaminidase Ig-fold domain (PF18368; HMM-score: 13.5)HTH (CL0123) HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 12.8)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 12.8)HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.959
- Cytoplasmic Membrane Score: 0.0032
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0375
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006009
- TAT(Tat/SPI): 0.000814
- LIPO(Sec/SPII): 0.000993
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001082471 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNRVKEFRKELGISQLELAKDIGVSRQTINMIENDKYNPTLELCLNLARSLQTDLNSLFWEDNF
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0303 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]