Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-MAR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SP49
- locus tag: BMJ42_RS08315 [old locus tag: BMJ42_01575 ]
- pan locus tag?: PNEUPAN000175000
- symbol: BMJ42_RS08315
- pan gene symbol?: —
- synonym:
- product: helix-turn-helix domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: BMJ42_RS08315 [old locus tag: BMJ42_01575 ]
- symbol: BMJ42_RS08315
- product: helix-turn-helix domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 1491012..1491362
- length: 351
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTTTCTTTGTTTGAAAAAATTAAAGAACTTTGCCAAAAACGAGGAATTTCTATAAAT
TCTCTCGAAGAAACACTTGGATATAGCAGAAATACAATCTATAGCATGAAGAGTAAAAAA
CCAAATGCTGAAAGATTACAAGAAATCGCCGACTACTTCAATGTCTCAACTGACTACTTA
CTTGGCCGTACAGATAATCCAGTTATAGCTGGAGATAAGGTCGCAAAGGCAGAAATAGAC
CTCAAAAAAGACGCAGCAGAAAGTTTCTTTTACGATGGACACGAACTCAACGACGAGGAT
TTAGACCTCATCTCCTCACTACTAGAAGCTCGTATGAGAAATAGAAAGTAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: BMJ42_RS08315 [old locus tag: BMJ42_01575 ]
- symbol: BMJ42_RS08315
- description: helix-turn-helix domain-containing protein
- length: 116
- theoretical pI: 4.99362
- theoretical MW: 13330
- GRAVY: -0.607759
⊟Function[edit | edit source]
- TIGRFAM: FkbH domain (TIGR01686; HMM-score: 12)Mobile and extrachromosomal element functions Prophage functions phage-associated protein, BcepMu gp16 family (TIGR04111; HMM-score: 11.8)
- TheSEED:
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 38.1)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 34.1)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 33.8)and 7 moreHTH_11; HTH domain (PF08279; HMM-score: 21.2)BetR; BetR domain (PF08667; HMM-score: 16.4)HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 16.2)NUMOD1; NUMOD1 domain (PF07453; HMM-score: 15.5)UBA (CL0214) UBA_2; Ubiquitin associated domain (UBA) (PF08587; HMM-score: 14.8)HTH (CL0123) HTH_60; Helix-turn-helix domain (PF20317; HMM-score: 14)HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9902
- Cytoplasmic Membrane Score: 0.0011
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0085
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00845
- TAT(Tat/SPI): 0.001057
- LIPO(Sec/SPII): 0.001886
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_073177133 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MFSLFEKIKELCQKRGISINSLEETLGYSRNTIYSMKSKKPNAERLQEIADYFNVSTDYLLGRTDNPVIAGDKVAKAEIDLKKDAAESFFYDGHELNDEDLDLISSLLEARMRNRK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]