Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 19-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Xen35
- locus tag: CXP32_RS00970 [old locus tag: CXP32_00970 ]
- pan locus tag?: PNEUPAN000920000
- symbol: spx
- pan gene symbol?: spxA2
- synonym:
- product: transcriptional regulator Spx
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: CXP32_RS00970 [old locus tag: CXP32_00970 ]
- symbol: spx
- product: transcriptional regulator Spx
- replicon: chromosome
- strand: +
- coordinates: 180894..181292
- length: 399
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CP025256 (180894..181292) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0178 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATTAAAATTTATACAGTCTCAAGTTGTACTAGCTGTAAAAAAGCAAAAACCTGGCTC
AATGCCCACCAGTTAAGTTATAAAGAACAAAACCTTGGTAAAGAAGGAATTACGAGAGAA
GAATTACTGGATATTCTAACCAAAACAGATAACGGAATAGCCAGCATCGTTTCGTCTAAA
AATCGCTATGCCAAAGCCCTTGGAGTGGATATTGAAGATTTGAGTGTCAATGAAGTTCTC
AATCTGATTATGGAAACACCGAGAATTTTAAAGAGCCCAATCCTTGTAGATGAAAAACGC
CTGCAAGTTGGCTACAAGGAAGACGATATTCGTGCCTTCCTACCACGCTCTGTCCGTAAT
GTAGAAAATGCAGAAGCACGTTTGCGTGCAGCTCTATAA60
120
180
240
300
360
399
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: CXP32_RS00970 [old locus tag: CXP32_00970 ]
- symbol: Spx
- description: transcriptional regulator Spx
- length: 132
- theoretical pI: 9.11716
- theoretical MW: 14890.1
- GRAVY: -0.303788
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 115.7)and 8 moreglutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 35.2)Cellular processes Detoxification arsenate reductase (glutaredoxin) (TIGR00014; EC 1.20.4.1; HMM-score: 30.2)glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 23.9)Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 23.4)glutaredoxin-like protein (TIGR02200; HMM-score: 17.6)glutaredoxin-family domain (TIGR02190; HMM-score: 17.1)Unknown function General nitrogenase-associated protein (TIGR01616; HMM-score: 14.2)Energy metabolism Sugars lactaldehyde reductase (TIGR02638; EC 1.1.1.77; HMM-score: 12.5)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: Thioredoxin (CL0172) ArsC; ArsC family (PF03960; HMM-score: 66.5)and 1 moreGlutaredoxin; Glutaredoxin (PF00462; HMM-score: 27.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7939
- Cytoplasmic Membrane Score: 0.0783
- Cell wall & surface Score: 0.0081
- Extracellular Score: 0.1197
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014734
- TAT(Tat/SPI): 0.000348
- LIPO(Sec/SPII): 0.011418
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000591165 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDILTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQVGYKEDDIRAFLPRSVRNVENAEARLRAAL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0178 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]