Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 17-FEB-2021
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Xen35
- locus tag: CXP32_RS03650 [old locus tag: CXP32_03650 ]
- pan locus tag?: PNEUPAN001679000
- symbol: CXP32_RS03650
- pan gene symbol?: —
- synonym:
- product: lactoylglutathione lyase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: CXP32_RS03650 [old locus tag: CXP32_03650 ]
- symbol: CXP32_RS03650
- product: lactoylglutathione lyase
- replicon: chromosome
- strand: +
- coordinates: 696747..697094
- length: 348
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP025256 (696747..697094) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0637 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATTTAAATCAATTAGATATTATCGTTTCAAATGTTCCCCAAGTCTGTGCTGACTTG
GAGCATATCTTGGATAAAAAGGCAGATTATGCTAATGATGGTTTTGCTCAGTTTACGATT
GGTAGTCACTGCCTTATGTTGTCACAAAATCATTTGGTTCCTTTGGAAAACTTTCAGTCA
GGAATCATTATTCATATCGAGGTTGAGGATGTAGACCAGAACTACAAACGGTTGAACGAG
CTTGGTATAAAGGTTTTACACGGACCAACTGTAACCGATTGGGGAACAGAGTCCTTATTA
GTTCAAGGACCTGCTGGTCTAGTGCTTGATTTTTATCGTATGAAATAG60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: CXP32_RS03650 [old locus tag: CXP32_03650 ]
- symbol: CXP32_RS03650
- description: lactoylglutathione lyase
- length: 115
- theoretical pI: 4.59421
- theoretical MW: 12888.7
- GRAVY: -0.0026087
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Other lactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 12.5)Central intermediary metabolism Amino sugars lactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 12.5)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: Glyoxalase (CL0104) Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 17)Glyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 16.8)Glyoxalase_3; Glyoxalase-like domain (PF13468; HMM-score: 15.5)and 1 moreGlyoxalase_6; Glyoxalase-like domain (PF18029; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003731
- TAT(Tat/SPI): 0.000174
- LIPO(Sec/SPII): 0.000879
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001052657 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNLNQLDIIVSNVPQVCADLEHILDKKADYANDGFAQFTIGSHCLMLSQNHLVPLENFQSGIIIHIEVEDVDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGPAGLVLDFYRMK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0637 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.