Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 12-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NCTC7466
- locus tag: DQM66_RS01410 [old locus tag: NCTC7466_00266 ]
- pan locus tag?: PNEUPAN001016000
- symbol: DQM66_RS01410
- pan gene symbol?: —
- synonym:
- product: GlsB/YeaQ/YmgE family stress response membrane protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: DQM66_RS01410 [old locus tag: NCTC7466_00266 ]
- symbol: DQM66_RS01410
- product: GlsB/YeaQ/YmgE family stress response membrane protein
- replicon: chromosome
- strand: +
- coordinates: 258004..258234
- length: 231
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_LS483374 (258004..258234) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0259 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTAGGAAGTATGTTCGTTGGTCTCCTAGTGGGATTTTTAGCAGGTGCTATGACCAAT
CGTGGAGAGCGAATGGGATGTTTTGGAAAAATGTTTCTCGGTTGGATCGGAGCCTTTCTA
GGTCACTTGCTCTTTGGAACTTGGGGGCCAGTTTTATCAGGAACAGCTATTATCCCAGCT
GTTTTAGGTGCCATGATTGTCTTAGCTATTTTTTGGAGACGAGGAAGTTAA60
120
180
231
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: DQM66_RS01410 [old locus tag: NCTC7466_00266 ]
- symbol: DQM66_RS01410
- description: GlsB/YeaQ/YmgE family stress response membrane protein
- length: 76
- theoretical pI: 12.0533
- theoretical MW: 8048.76
- GRAVY: 1.09079
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for D39, TIGR4
- PFAM: no clan defined Transgly_assoc; Transglycosylase associated protein (PF04226; HMM-score: 29.5)and 7 moreMpo1-like; 2-hydroxy-palmitic acid dioxygenase Mpo1-like (PF06127; HMM-score: 12.7)DUF5518; Family of unknown function (DUF5518) (PF17647; HMM-score: 12.1)DUF6703; Family of unknown function (DUF6703) (PF20444; HMM-score: 12)Glycine-zipper (CL0500) Rick_17kDa_Anti; Glycine zipper 2TM domain (PF05433; HMM-score: 10)no clan defined Gly_transporter; Glycine transporter (PF03458; HMM-score: 9.2)TM_helix; Conserved TM helix (PF05552; HMM-score: 7)BPD_transp_1 (CL0404) LptF_LptG; Lipopolysaccharide export system permease LptF/LptG (PF03739; HMM-score: 6.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0007
- Cytoplasmic Membrane Score: 0.9973
- Cell wall & surface Score: 0
- Extracellular Score: 0.002
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.038276
- TAT(Tat/SPI): 0.00219
- LIPO(Sec/SPII): 0.252278
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000901567 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLFGTWGPVLSGTAIIPAVLGAMIVLAIFWRRGS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0259 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]