Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 14-DEC-2020
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NCTC7466
- locus tag: DQM66_RS09870 [old locus tag: NCTC7466_01896 ]
- pan locus tag?: PNEUPAN003608000
- symbol: DQM66_RS09870
- pan gene symbol?: comGE
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: DQM66_RS09870 [old locus tag: NCTC7466_01896 ]
- symbol: DQM66_RS09870
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1840594..1840854
- length: 261
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_LS483374 (1840594..1840854) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1859 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGATTTTACTGGAAGCAGTAGTCGCTCTAGCTATCTTTGCCAGCATTGCGACCCTCCTT
TTGGGACAAATTCAAAAAAATAGGCAAGAGGAAGCAAAAATCTTGCAAAAGGAAGAAGTC
TTGAGGGTAGCTAAGATGGCCCTGCAGACGGGGCAAAATCAGGTAAGCATCAACGGAGTT
GAGATTCAGGTATTTTCTAGTGAAAAAGGATTGGAGGTCTACCATGGTTCAGAACAGTTG
TTGGCAATCAAAGAGCCATAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: DQM66_RS09870 [old locus tag: NCTC7466_01896 ]
- symbol: DQM66_RS09870
- description: hypothetical protein
- length: 86
- theoretical pI: 5.05377
- theoretical MW: 9459
- GRAVY: 0.20814
⊟Function[edit | edit source]
- TIGRFAM: type II secretion system protein I (TIGR01707; HMM-score: 22.2)and 1 moretype II secretion system protein J (TIGR01711; HMM-score: 12.1)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: no clan defined PulG; Type II secretory pathway pseudopilin (PF11773; HMM-score: 82.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helix: 1
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.233774
- TAT(Tat/SPI): 0.006664
- LIPO(Sec/SPII): 0.32688
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000601740 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MILLEAVVALAIFASIATLLLGQIQKNRQEEAKILQKEEVLRVAKMALQTGQNQVSINGVEIQVFSSEKGLEVYHGSEQLLAIKEP
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1859 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.