Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 16-MAY-2019
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae EF3030
- locus tag: EF3030_07170
- pan locus tag?:
- symbol: EF3030_07170
- pan gene symbol?: —
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EF3030_07170
- symbol: EF3030_07170
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1370392..1370931
- length: 540
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP035897 (1370392..1370931) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481TTGACTGAAAAGATTCAAGAACATGAATTAATTAAGACTAACCAAGCAGAGAAAAGTGTA
CAGGATGTTTTGGATAATTGTATTGAAAGGGTACAAAACAATTCACTGAAATCAGATAGG
GTTACTTCTTTTGAGACCCCGTTTGCTCTCTTATTTATCTTTGCGACTATAGCTGTGATG
CTAACCTATGGGGGTTATCGGGTCAGCGCAGGATATATATCTGTGGGAACCTTGGTTTCG
TTTTTGATTTACCTCTTTCAATTACTTAATCCTATTAGTAATATAGCTAATTTTGTAACT
GTTTATTCTAGGAGCAAGGGATCTTCAGTTGCACTGGATAACTTGCTTGCAGTTCCTAAA
GAAAAATTTGAGGGAGGAAAATCGGTATCAGGACAAGGGTTGAATTTTAACCATGTCTAT
TTTGGTTATGATGAAAATCGACCTGTCTTAAAGGATATTACTTGTTCAATTTTCAAGGGG
CAAAAATTGCTTTTGTTGGACCATCTGGATCAGGAAAATCAACGATTGTGCGTTTGTTAG60
120
180
240
300
360
420
480
540
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EF3030_07170
- symbol: EF3030_07170
- description: ABC transporter ATP-binding protein
- length: 179
- theoretical pI: 6.76402
- theoretical MW: 20067.9
- GRAVY: 0.0284916
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 68.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 68.7)and 14 moreCell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 47.6)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 47.6)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 42.5)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 42.5)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 42.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 39.7)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 36.8)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 36.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 34.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 34.3)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 20.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 17.4)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 15.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 15.7)
- TheSEED:
- PFAM: ABC_membrane (CL0241) ABC_membrane; ABC transporter transmembrane region (PF00664; HMM-score: 34.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.007
- Cytoplasmic Membrane Score: 0.9032
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0894
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003382
- TAT(Tat/SPI): 0.000286
- LIPO(Sec/SPII): 0.001638
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: QBF69278 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTEKIQEHELIKTNQAEKSVQDVLDNCIERVQNNSLKSDRVTSFETPFALLFIFATIAVMLTYGGYRVSAGYISVGTLVSFLIYLFQLLNPISNIANFVTVYSRSKGSSVALDNLLAVPKEKFEGGKSVSGQGLNFNHVYFGYDENRPVLKDITCSIFKGQKLLLLDHLDQENQRLCVC
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]