Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 16-MAY-2019
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae EF3030
- locus tag: EF3030_08395
- pan locus tag?:
- symbol: EF3030_08395
- pan gene symbol?: —
- synonym:
- product: glycosyltransferase family 2 protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EF3030_08395
- symbol: EF3030_08395
- product: glycosyltransferase family 2 protein
- replicon: chromosome
- strand: -
- coordinates: 1604778..1605056
- length: 279
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP035897 (1604778..1605056) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAAAATGAACTAATTAGTATTGTAGTCCCAATCTACAACGTTGAGAATTATTTGCGA
ATGTGTTTGGATAGCATTCAGAATCAGACGTATCAAAATTTTGAGTGTTTATTAATCAAT
GATGGCTCTCCAGATCATTCATCCAAAATATGTGAAGAATTTGTAGAGAAAGATTCTCGT
TTCAAATATTTTGAGAAAGCAAACGGCGGTCTTTCATCAGCTCGTAACCTAGGTATTGAA
TGTTCGGGGGGGGGCGTACATTACTTTTGTAGACTCTGA60
120
180
240
279
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EF3030_08395
- symbol: EF3030_08395
- description: glycosyltransferase family 2 protein
- length: 92
- theoretical pI: 4.58008
- theoretical MW: 10492.8
- GRAVY: -0.3
⊟Function[edit | edit source]
- TIGRFAM: poly-beta-1,6 N-acetyl-D-glucosamine synthase (TIGR03937; EC 2.4.1.-; HMM-score: 49.2)and 9 moreputative glycosyltransferase, exosortase G-associated (TIGR03111; HMM-score: 37.6)Unknown function Enzymes of unknown specificity transferase 2, rSAM/selenodomain-associated (TIGR04283; EC 2.-.-.-; HMM-score: 28.5)mycofactocin system glycosyltransferase (TIGR03965; HMM-score: 27)colanic acid biosynthesis glycosyltransferase WcaA (TIGR04017; EC 2.4.-.-; HMM-score: 25.5)chitooligosaccharide synthase NodC (TIGR04242; EC 2.4.1.-; HMM-score: 23)glycosyltransferase domain (TIGR04440; EC 2.-.-.-; HMM-score: 17.1)hopene-associated glycosyltransferase HpnB (TIGR03469; HMM-score: 16.2)antiviral radical SAM protein viperin (TIGR04278; HMM-score: 14.2)peptide S-glycosyltransferase, SunS family (TIGR04195; EC 2.4.1.-; HMM-score: 12.5)
- TheSEED:
- PFAM: GT-A (CL0110) Glycos_transf_2; Glycosyl transferase family 2 (PF00535; HMM-score: 78.8)and 3 moreGlyco_tranf_2_2; Glycosyltransferase like family 2 (PF10111; HMM-score: 26.9)Glyco_tranf_2_3; Glycosyltransferase like family 2 (PF13641; HMM-score: 22.9)Rhamno_transf; Putative rhamnosyl transferase (PF11316; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6961
- Cytoplasmic Membrane Score: 0.1747
- Cell wall & surface Score: 0.0011
- Extracellular Score: 0.128
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011996
- TAT(Tat/SPI): 0.0001
- LIPO(Sec/SPII): 0.001199
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: QBF69497 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MENELISIVVPIYNVENYLRMCLDSIQNQTYQNFECLLINDGSPDHSSKICEEFVEKDSRFKYFEKANGGLSSARNLGIECSGGGVHYFCRL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]