Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 12-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 49619
- locus tag: EL263_RS08560 [old locus tag: SPAT_1630 ]
- pan locus tag?: PNEUPAN003255000
- symbol: EL263_RS08560
- pan gene symbol?: natA_7
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EL263_RS08560 [old locus tag: SPAT_1630 ]
- symbol: EL263_RS08560
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1618593..1619363
- length: 771
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGCTCTATTTGTGGGGGAAAGAAAGAGTGAAGAAGTTAAGTGTTAAAAATCTAAAAAAG
CAATATGGTTCTTATGAAGCTGTCAAGGGAATTAGCTTTGAATTGGGAGAAGGAGAGTGT
TTGGGTATCTTGGGAATCAACGGTGCTGGCAAAACATCCACTTTAAAGATGATTTACTCA
CTGACCTCAATTTCCTCAGGAGAGATTGATATCTTGGGGAAAAATATTGAAACCAATCGT
CGTAAGAGTAAATCTTGTCTGGGTATTGTAGGGCAGGAGGATATGCTGGACATGACCTTG
AATGTTTATGATAATCTTTTTGCTCACGGTCTATGTTATGGTATCTCATCTGTCGAACTT
AGGAAGAGAATCGATTCTCTCTTGGATTTTGTTCAACTGAGCAAACATGCGCAAAAGATG
GTGAATCAGCTGTCGGGTGGGATGCGACGACGTCTTGTCTTGGCAAGAGCTCTCATCAAT
CGACCTGATATTATCATTTTAGATGAACCGACAGTTGGTTTAGACATTCAATCCCGCAAT
ATTATTTGGGATAAACTTTTGGAGTTGAAGGAATTAGGTGTTTCCATCATTATTACTTCC
CACTATATGAATGAGATTGAATATTTGACAGATAGGGTGCTGATGCTCCACCAAGGGACT
ATCAAAGAAGAAGGAACTGTAGAAGACTTGCTCATCAAGTATGATGCTGACAACCTTGAG
ACGCTTTTTTTGGGGTTGACTGGGACAGAGAAGGAGGACTTGCATGTTTAA60
120
180
240
300
360
420
480
540
600
660
720
771
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EL263_RS08560 [old locus tag: SPAT_1630 ]
- symbol: EL263_RS08560
- description: ABC transporter ATP-binding protein
- length: 256
- theoretical pI: 6.37007
- theoretical MW: 28793.3
- GRAVY: -0.0835937
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 223.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 204)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 196.1)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 196.1)and 67 moregliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 143.4)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 143.1)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 142.4)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 142.4)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 141.8)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 133)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 131.8)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 130)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 127)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 125.6)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 119.6)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 117.5)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 117.4)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 115.9)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 114.5)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 113.8)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 108.7)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 108.7)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 107.6)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 106.4)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 105.8)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 105.8)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 105.4)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 105.2)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 104.7)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 103.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 102.4)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 101.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 101.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 101.5)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 101.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 101.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 100.7)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 99.4)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 97.7)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 96.8)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 92.9)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 91.1)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.8)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 88.5)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 88.1)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 87.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 86.4)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 84.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 84.3)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 83.7)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 82)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 82)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 80.7)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 80.3)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 75.4)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 75)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 74.5)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 74.1)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 72.5)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 72.5)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 72.5)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 70.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 67.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 54.6)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 46.8)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 42.2)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 40.6)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 40.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 32)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 28.1)
- TheSEED:
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 110.1)and 4 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 34.8)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 18.3)AAA_15; AAA ATPase domain (PF13175; HMM-score: 16.7)Cupin (CL0029) FdtA; WxcM-like, C-terminal (PF05523; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0957
- Cytoplasmic Membrane Score: 0.8739
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.03
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.067954
- TAT(Tat/SPI): 0.000622
- LIPO(Sec/SPII): 0.00117
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000966492 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLYLWGKERVKKLSVKNLKKQYGSYEAVKGISFELGEGECLGILGINGAGKTSTLKMIYSLTSISSGEIDILGKNIETNRRKSKSCLGIVGQEDMLDMTLNVYDNLFAHGLCYGISSVELRKRIDSLLDFVQLSKHAQKMVNQLSGGMRRRLVLARALINRPDIIILDEPTVGLDIQSRNIIWDKLLELKELGVSIIITSHYMNEIEYLTDRVLMLHQGTIKEEGTVEDLLIKYDADNLETLFLGLTGTEKEDLHV
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]