Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 12-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae HU-OH
- locus tag: EL271_RS04145 [old locus tag: SPOH_0768 ]
- pan locus tag?: PNEUPAN001861000
- symbol: EL271_RS04145
- pan gene symbol?: argR2
- synonym:
- product: arginine repressor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EL271_RS04145 [old locus tag: SPOH_0768 ]
- symbol: EL271_RS04145
- product: arginine repressor
- replicon: chromosome
- strand: -
- coordinates: 773379..773849
- length: 471
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_AP018937 (773379..773849) NCBI
- BioCyc: EL271_RS04145 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0786 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAATAAATCAGAACACCGCCACCAACTTATACGCGCTCTTATCACAAAAAACAAGATT
CATACACAGGCTGAGTTGCAAGCCCTTCTTGCTGAGAACGACATTCAAGTAACCCAGGCA
ACCCTCTCACGCGACATCAAAAATATGAACCTATCAAAAGTCCGCGAAGAAGATAGCGCT
TATTATGTTCTTAACAATGGTTCCATCTCAAAATGGGAAAAACGTCTCGAACTCTACATG
GAAGACGCCCTTGTCTGGATGCGCCCAGTTCAACACCAAGTCCTACTAAAAACCCTTCCT
GGACTGGCTCAATCCTTTGGTTCTATCATTGATACTTTGAGCTTCCCTGACGCTATCGCT
ACCCTTTGTGGTAATGATGTCTGTCTTATCATCTGTGAAGATGCAGATACTGCTCAAAAG
TGCTTTGAAGAACTGAAAAAATTCGCCCCACCATTTTTCTTTGAAGAATAA60
120
180
240
300
360
420
471
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EL271_RS04145 [old locus tag: SPOH_0768 ]
- symbol: EL271_RS04145
- description: arginine repressor
- length: 156
- theoretical pI: 5.26582
- theoretical MW: 17842.4
- GRAVY: -0.228205
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Glutamate family arginine repressor (TIGR01529; HMM-score: 119.5)Regulatory functions DNA interactions arginine repressor (TIGR01529; HMM-score: 119.5)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) Arg_repressor; Arginine repressor, DNA binding domain (PF01316; HMM-score: 79.7)no clan defined Arg_repressor_C; Arginine repressor, C-terminal domain (PF02863; HMM-score: 63.8)and 6 moreSMC_hinge; SMC proteins Flexible Hinge Domain (PF06470; HMM-score: 19.7)DUF3135; Protein of unknown function (DUF3135) (PF11333; HMM-score: 13.8)NADP_Rossmann (CL0063) PRMT5; PRMT5 arginine-N-methyltransferase (PF05185; HMM-score: 13.6)RRM (CL0221) SET_assoc; Histone lysine methyltransferase SET associated (PF11767; HMM-score: 13.1)HTH (CL0123) HTH_Tnp_Tc3_2; Transposase (PF01498; HMM-score: 12.8)no clan defined DUF3427; Domain of unknown function (DUF3427) (PF11907; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by ArgR2*, TF important in Arginine biosynthesis, Arginine degradation: in TIGR4
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9535
- Cytoplasmic Membrane Score: 0.0322
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0137
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014337
- TAT(Tat/SPI): 0.002809
- LIPO(Sec/SPII): 0.001658
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001042995 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNKSEHRHQLIRALITKNKIHTQAELQALLAENDIQVTQATLSRDIKNMNLSKVREEDSAYYVLNNGSISKWEKRLELYMEDALVWMRPVQHQVLLKTLPGLAQSFGSIIDTLSFPDAIATLCGNDVCLIICEDADTAQKCFEELKKFAPPFFFEE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0786 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Christian Schulz, Philipp Gierok, Lothar Petruschka, Michael Lalk, Ulrike Mäder, Sven Hammerschmidt
Regulation of the arginine deiminase system by ArgR2 interferes with arginine metabolism and fitness of Streptococcus pneumoniae.
mBio: 2014, 5(6);
[PubMed:25538192] [WorldCat.org] [DOI] (I e)