Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 12-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NU83127
- locus tag: EL277_RS03660 [old locus tag: SPNU_0687 ]
- pan locus tag?: PNEUPAN001649000
- symbol: EL277_RS03660
- pan gene symbol?: copY
- synonym:
- product: CopY/TcrY family copper transport repressor
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EL277_RS03660 [old locus tag: SPNU_0687 ]
- symbol: EL277_RS03660
- product: CopY/TcrY family copper transport repressor
- replicon: chromosome
- strand: +
- coordinates: 697093..697488
- length: 396
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_AP018936 (697093..697488) NCBI
- BioCyc: EL277_RS03660 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0633 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCAGATTTCAGATGCAGAATGGCAGGTCATGAAGATTATTTGGATGCAGGGGGAGCAG
ACCAGTACAGATTTGATTAGGGTTTTGGCAGAGCGGTTTGACTGGTCCAAGTCCACGGTT
CAGACACTTTTGGCTCGTCTGGTTGATAAAGAGTGTTTGACTCGGAAAAAAGAAGGCAAG
TCCTTTGTTTATTCAGCCCTTTTAACTCTAGACCAAAGTCGGGATTTACTTGTCCAAGAT
ATCAAAGACAAGGTTTGTTCCCGTAGGATTAGGAATTTGTTGGCTGACTTGATTGTAGAA
TGTGAATTTACTCAGACTGACTTGGAAGACTTGGAAGCTGTGATTTCAGAGAAGAAATCA
AGTGCTGTAACAGAAGTAAGATGTAATTGTATGTAA60
120
180
240
300
360
396
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EL277_RS03660 [old locus tag: SPNU_0687 ]
- symbol: EL277_RS03660
- description: CopY/TcrY family copper transport repressor
- length: 131
- theoretical pI: 4.8194
- theoretical MW: 15134.4
- GRAVY: -0.208397
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 182)Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 182)and 4 moreEnergy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 20.4)Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 20.4)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.3)Regulatory functions DNA interactions phenylacetic acid degradation operon negative regulatory protein PaaX (TIGR02277; HMM-score: 12.5)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 114.4)and 15 moreMarR; MarR family (PF01047; HMM-score: 30.4)MarR_2; MarR family (PF12802; HMM-score: 27.5)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 18.9)PaaX; PaaX-like protein (PF07848; HMM-score: 18.4)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 17.9)GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 16.6)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 16)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 15.9)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 15.7)no clan defined GPP34; Golgi phosphoprotein 3 (GPP34) (PF05719; HMM-score: 14.7)HTH (CL0123) TBPIP; TBPIP/Hop2 winged helix domain (PF07106; HMM-score: 14.7)ANAPC2; Anaphase promoting complex (APC) subunit 2 (PF08672; HMM-score: 13.9)Ferritin (CL0044) DUF2202; Uncharacterized protein domain (DUF2202) (PF09968; HMM-score: 13.1)HTH (CL0123) SMC_ScpB; Segregation and condensation complex subunit ScpB (PF04079; HMM-score: 12.8)PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9833
- Cytoplasmic Membrane Score: 0.0092
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0072
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004684
- TAT(Tat/SPI): 0.00026
- LIPO(Sec/SPII): 0.001069
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001167211 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDWSKSTVQTLLARLVDKECLTRKKEGKSFVYSALLTLDQSRDLLVQDIKDKVCSRRIRNLLADLIVECEFTQTDLEDLEAVISEKKSSAVTEVRCNCM
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0633 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Sulman Shafeeq, Hasan Yesilkaya, Tomas G Kloosterman, Geetha Narayanan, Michal Wandel, Peter W Andrew, Oscar P Kuipers, Julie A Morrissey
The cop operon is required for copper homeostasis and contributes to virulence in Streptococcus pneumoniae.
Mol Microbiol: 2011, 81(5);1255-70
[PubMed:21736642] [WorldCat.org] [DOI] (I p)Miranda J Neubert, Elizabeth A Dahlmann, Andrew Ambrose, Michael D L Johnson
Copper Chaperone CupA and Zinc Control CopY Regulation of the Pneumococcal cop Operon.
mSphere: 2017, 2(5);
[PubMed:29062896] [WorldCat.org] [DOI] (P e)