Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 12-MAY-2020
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 6A-10
- locus tag: HKM25_2086 [new locus tag: HKM25_RS10185 ]
- pan locus tag?: PNEUPAN003651000
- symbol: HKM25_2086
- pan gene symbol?: —
- synonym:
- product: AAA domain protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HKM25_2086 [new locus tag: HKM25_RS10185 ]
- symbol: HKM25_2086
- product: AAA domain protein
- replicon: chromosome
- strand: -
- coordinates: 1982289..1982483
- length: 195
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP053210 (1982289..1982483) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1828 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAGGGGAAAGAGTATGAAAACAGAACTGTTTCTTTTGCTATTAGTTCAAAAGGAGAA
AAAATGAAAGTAGAAAATATTTCGTATAGGGTGGATCATCGTATATTGTTTGATAATATT
TCTTTTGATACTTCGAGTTCAGGCGTGACATTAATTACTGGTAAAAATGGTACAGGAAAG
TCAACTTTACTATAG60
120
180
195
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HKM25_2086 [new locus tag: HKM25_RS10185 ]
- symbol: HKM25_2086
- description: AAA domain protein
- length: 64
- theoretical pI: 10.0574
- theoretical MW: 7087.99
- GRAVY: -0.475
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 27.3)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 27.3)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 27.2)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 24.2)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 22.3)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 22.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 22.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 22.1)and 35 moreTransport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 21.3)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 21)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 20.1)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 18.6)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 17.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 17)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 16.9)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 16.9)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 16.9)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 16.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 16.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 16.6)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 16.5)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 15.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 15.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 15.7)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 14.2)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 14.1)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 14.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 14.1)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 13.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 13.7)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 13.7)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 13.6)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 13.5)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 13.1)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 13.1)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 12.8)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 12.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 12.3)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 11)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 11)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 10.8)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 10.8)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 10.8)
- TheSEED: data available for D39, Hungary19A-6
- PFAM: P-loop_NTPase (CL0023) AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 29.2)AAA_23; AAA domain (PF13476; HMM-score: 27.1)ABC_tran; ABC transporter (PF00005; HMM-score: 24.6)and 11 moreAAA_27; AAA domain (PF13514; HMM-score: 15.2)AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.7)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 14.6)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 14.3)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 13.9)AAA_22; AAA domain (PF13401; HMM-score: 13.4)AAA_30; AAA domain (PF13604; HMM-score: 13.4)AAA_15; AAA ATPase domain (PF13175; HMM-score: 13.3)ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 13.2)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 12.1)AAA_25; AAA domain (PF13481; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7414
- Cytoplasmic Membrane Score: 0.1515
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.1068
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.067464
- TAT(Tat/SPI): 0.002888
- LIPO(Sec/SPII): 0.005066
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: QJS37751 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKGKEYENRTVSFAISSKGEKMKVENISYRVDHRILFDNISFDTSSSGVTLITGKNGTGKSTLL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1828 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]