Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 12-MAY-2020
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 6A-10
- locus tag: HKM25_2130 [new locus tag: HKM25_RS10390 ]
- pan locus tag?: PNEUPAN003697000
- symbol: HKM25_2130
- pan gene symbol?: marR_2
- synonym:
- product: transcriptional regulator, MarR family
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HKM25_2130 [new locus tag: HKM25_RS10390 ]
- symbol: HKM25_2130
- product: transcriptional regulator, MarR family
- replicon: chromosome
- strand: -
- coordinates: 2020275..2020700
- length: 426
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP053210 (2020275..2020700) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1872 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGCTAGAGATTCAAGATTTACTGTATCAACTCCGCTTGTCTGAGCAAGCGAGTACGCAA
TTGTTTGAAAAAAGGCTTGGGATTAGTTTGACACGGTATCAGATTTTACTGTTTTTGCTG
GAGCATTCTCCTTGTAACCAAATGGCGGTTCAGGAGCGTTTGAAAATTGATCAGGCTGCT
TTGACACGGCATTTCAAGATTTTGGAAACGGAAGGTTTGGTGGAGCGTCATCGTAATCCT
GAAAATCAGCGGGAAGTGTTGGTAGAGGCTGCGAAGTATGCCAAGGAGCAGTTAGTGGTG
AATCCCCCTCTGCAACATATCAAGGTTAAGGAAGAGATGGAAAGTATCTTAACAGAGTTT
GAGAGAACAGAACTCAGCCGTTTATTAAATAAATTGGTTTTGGGTATTGAAAATATAGAA
ATTTAA60
120
180
240
300
360
420
426
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HKM25_2130 [new locus tag: HKM25_RS10390 ]
- symbol: HKM25_2130
- description: transcriptional regulator, MarR family
- length: 141
- theoretical pI: 5.69077
- theoretical MW: 16575.1
- GRAVY: -0.286525
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 26.6)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 25.8)Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 25.8)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 25.5)
- TheSEED: data available for Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 49)MarR_2; MarR family (PF12802; HMM-score: 42.4)and 8 moreHTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 27.8)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.5)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 22.5)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 19.5)TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 18.9)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 16.1)HTH_12; Ribonuclease R winged-helix domain (PF08461; HMM-score: 14.7)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9977
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0017
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009092
- TAT(Tat/SPI): 0.001155
- LIPO(Sec/SPII): 0.001811
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: QJS37795 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLEIQDLLYQLRLSEQASTQLFEKRLGISLTRYQILLFLLEHSPCNQMAVQERLKIDQAALTRHFKILETEGLVERHRNPENQREVLVEAAKYAKEQLVVNPPLQHIKVKEEMESILTEFERTELSRLLNKLVLGIENIEI
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1872 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]