Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 24-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 6A-10
- locus tag: HKM25_RS08095 [old locus tag: HKM25_1654 ]
- pan locus tag?: PNEUPAN003006000
- symbol: HKM25_RS08095
- pan gene symbol?: fer
- synonym:
- product: ferredoxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HKM25_RS08095 [old locus tag: HKM25_1654 ]
- symbol: HKM25_RS08095
- product: ferredoxin
- replicon: chromosome
- strand: +
- coordinates: 1578143..1578349
- length: 207
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CP053210 (1578143..1578349) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1430 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAAATCACACTTATACCTGAACGATGTATCGCCTGTGGACTTTGCCAAACTTATTCT
GATTTATTTGATTACCACGATAATGGAATCGTGCGTTTTTACGATGACCCTGACCAACTG
GAAAAAGAAATTTCTCCTAGTCAGGATGTCTTAGAGGCTGTTAAAAATTGCCCAACTCGC
GCCCTGATTGGAAACCAGGAAGCCTAA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HKM25_RS08095 [old locus tag: HKM25_1654 ]
- symbol: HKM25_RS08095
- description: ferredoxin
- length: 68
- theoretical pI: 4.16302
- theoretical MW: 7705.67
- GRAVY: -0.35
⊟Function[edit | edit source]
- TIGRFAM: Central intermediary metabolism Sulfur metabolism sulfite reductase, dissimilatory-type beta subunit (TIGR02066; EC 1.8.99.3; HMM-score: 15.2)
- TheSEED: data available for D39, TIGR4
- PFAM: 4Fe-4S (CL0344) Fer4_13; 4Fe-4S single cluster domain of Ferredoxin I (PF13370; HMM-score: 33.2)Fer4_15; 4Fe-4S single cluster domain (PF13459; HMM-score: 28.1)and 5 moreFer4; 4Fe-4S binding domain (PF00037; HMM-score: 23.4)Fer4_19; Divergent 4Fe-4S mono-cluster (PF06902; HMM-score: 18.6)Fer4_2; 4Fe-4S binding domain (PF12797; HMM-score: 17.6)Fer4_6; 4Fe-4S binding domain (PF12837; HMM-score: 15.9)Fer4_7; 4Fe-4S dicluster domain (PF12838; HMM-score: 15.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9538
- Cytoplasmic Membrane Score: 0.0253
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0207
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.022763
- TAT(Tat/SPI): 0.000294
- LIPO(Sec/SPII): 0.00706
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000705155 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKITLIPERCIACGLCQTYSDLFDYHDNGIVRFYDDPDQLEKEISPSQDVLEAVKNCPTRALIGNQEA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1430 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]