Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 28-AUG-2013
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TCH8431/19A
- locus tag: HMPREF0837_10549 [new locus tag: HMPREF0837_RS02695 ]
- pan locus tag?: PNEUPAN000967000
- symbol: HMPREF0837_10549
- pan gene symbol?: —
- synonym:
- product: ACT domain protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF0837_10549 [new locus tag: HMPREF0837_RS02695 ]
- symbol: HMPREF0837_10549
- product: ACT domain protein
- replicon: chromosome
- strand: +
- coordinates: 484481..484819
- length: 339
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001993 (484481..484819) NCBI
- BioCyc: see HMPREF0837_RS02695
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0220 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCTATACTATTTGAAAAGAATCCTGTTTAATGTTAAGGTTTCTTATTTTAAGAAGAAT
TGGAGTTTACTTATGAAAGCCATTATAACTGTTGTTGGTAAAGATAAATCTGGAATTGTT
GCAGGTGTTTCTGGTAAAATTGCAGAATTAGGATTGAATATTGACGATATCTCTCAAACT
GTATTGGATGAATATTTTACGATGATGGCTGTTGTATCTAGTGATGAAAAGCAAGATTTT
ACCTATCTTCGTAATGAATTTGAAGCTTTTGGGCAAACTTTGAATGTAAAAATCAATATT
CAGAGTGCAGCGATTTTCGAAGCTATGTATAATATCTAG60
120
180
240
300
339
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF0837_10549 [new locus tag: HMPREF0837_RS02695 ]
- symbol: HMPREF0837_10549
- description: ACT domain protein
- length: 112
- theoretical pI: 6.80563
- theoretical MW: 12720.8
- GRAVY: 0.209821
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Pyruvate family acetolactate synthase, small subunit (TIGR00119; EC 2.2.1.6; HMM-score: 16.3)Amino acid biosynthesis Aspartate family aspartate kinase, monofunctional class (TIGR00656; EC 2.7.2.4; HMM-score: 14.1)and 1 morePurines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis formyltetrahydrofolate deformylase (TIGR00655; EC 3.5.1.10; HMM-score: 12.8)
- TheSEED :
- ACT domain protein CAC_0478
- PFAM: ACT (CL0070) ACT_6; ACT domain (PF13740; HMM-score: 46.3)and 3 moreACT; ACT domain (PF01842; HMM-score: 28.9)ACT_4; ACT domain (PF13291; HMM-score: 19.4)no clan defined DUF6486; Family of unknown function (DUF6486) (PF20096; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9473
- Cytoplasmic Membrane Score: 0.003
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0497
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.02848
- TAT(Tat/SPI): 0.001665
- LIPO(Sec/SPII): 0.009958
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADI68777 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLYYLKRILFNVKVSYFKKNWSLLMKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFEAMYNI
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0220 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.