Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 28-AUG-2013
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TCH8431/19A
- locus tag: HMPREF0837_12092 [new locus tag: HMPREF0837_RS10030 ]
- pan locus tag?: PNEUPAN003390000
- symbol: HMPREF0837_12092
- pan gene symbol?: galE_3
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF0837_12092 [new locus tag: HMPREF0837_RS10030 ]
- symbol: HMPREF0837_12092
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1917170..1917364
- length: 195
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001993 (1917170..1917364) NCBI
- BioCyc: see HMPREF0837_RS10030
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAACTACCTATTTCAAGAAGACAGTTCTTCTCAAATCTTTAACTTAGGAACTAAAAAA
GGCTATACTATCAAAGAAATCTTTAACTTAGGAACTAAAAAAGGCTATACTATCAAAGAA
ATCTTTAACTTAGGAACTAAAAAAGGCTATACTATCAAAGAAATCTTTAAAACTGCTGAA
GAATTACTAAATTAA60
120
180
195
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF0837_12092 [new locus tag: HMPREF0837_RS10030 ]
- symbol: HMPREF0837_12092
- description: hypothetical protein
- length: 64
- theoretical pI: 9.75327
- theoretical MW: 7389.47
- GRAVY: -0.482812
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Sugars UDP-glucose 4-epimerase GalE (TIGR01179; EC 5.1.3.2; HMM-score: 26)
- TheSEED :
- UDP-glucose 4-epimerase (EC 5.1.3.2)
Carbohydrates Di- and oligosaccharides Lactose and Galactose Uptake and Utilization UDP-glucose 4-epimerase (EC 5.1.3.2)and 2 more - PFAM: no clan defined RPAP1_C; RPAP1-like, C-terminal (PF08620; HMM-score: 28.6)and 5 moreExoX-like_C; Exodeoxyribonuclease X-like C-terminal (PF20600; HMM-score: 17.8)DUF1413; Domain of unknown function (DUF1413) (PF07205; HMM-score: 13.3)DUF5338; Family of unknown function (DUF5338) (PF17273; HMM-score: 13.3)KH (CL0007) KH_1; KH domain (PF00013; HMM-score: 13.1)no clan defined DUF6199; Family of unknown function (DUF6199) (PF19701; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4954
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.504
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.055892
- TAT(Tat/SPI): 0.000969
- LIPO(Sec/SPII): 0.004686
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADI70320 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNYLFQEDSSSQIFNLGTKKGYTIKEIFNLGTKKGYTIKEIFNLGTKKGYTIKEIFKTAEELLN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]