Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 25-OCT-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TCH8431/19A
- locus tag: HMPREF0837_RS03995 [old locus tag: HMPREF0837_10827 ]
- pan locus tag?: PNEUPAN001403000
- symbol: HMPREF0837_RS03995
- pan gene symbol?: blpI
- synonym:
- product: Blp family class II bacteriocin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF0837_RS03995 [old locus tag: HMPREF0837_10827 ]
- symbol: HMPREF0837_RS03995
- product: Blp family class II bacteriocin
- replicon: chromosome
- strand: +
- coordinates: 761076..761324
- length: 249
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTGGCTAGCATT
GAGGGAGGAACTGATTGGGGAACAGTAGGAAAAGGAGCTGTCTATGGAGCAGGTATCGGA
GTTGCTATGTGTGCGGTAGGAGGACTCCTTACTGGTGGTTCCACATGGGCTATGACTGCT
GGCTGTGCTTGGGCTGGAGCTAAACTTGGTGGTTCTTTTACTGCAATTGCTGATAATCTT
TGGCCATAG60
120
180
240
249
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF0837_RS03995 [old locus tag: HMPREF0837_10827 ]
- symbol: HMPREF0837_RS03995
- description: Blp family class II bacteriocin
- length: 82
- theoretical pI: 4.22902
- theoretical MW: 8210.42
- GRAVY: 0.414634
⊟Function[edit | edit source]
- TIGRFAM: bacteriocin-type signal sequence (TIGR01847; HMM-score: 17.9)and 1 moreTransport and binding proteins Cations and iron carrying compounds Na+/H+ antiporter NhaC (TIGR00931; HMM-score: 12.3)
- TheSEED: see HMPREF0837_10827
- PFAM: GG-leader (CL0400) Bacteriocin_IIc; Bacteriocin class II with double-glycine leader peptide (PF10439; HMM-score: 37.8)and 3 moreComC; COMC family (PF03047; HMM-score: 18)no clan defined Phage_holin_3_6; Putative Actinobacterial Holin-X, holin superfamily III (PF07332; HMM-score: 13.1)Lamprin; Lamprin (PF06403; HMM-score: 9.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 2
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 1
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.439395
- TAT(Tat/SPI): 0.020533
- LIPO(Sec/SPII): 0.006108
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001093269 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNTKMMSQFSVMDNEMLASIEGGTDWGTVGKGAVYGAGIGVAMCAVGGLLTGGSTWAMTAGCAWAGAKLGGSFTAIADNLWP
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]