Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 02-AUG-2013
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae gamPNI0373
- locus tag: HMPREF1038_01726 [new locus tag: HMPREF1038_RS08475 ]
- pan locus tag?: PNEUPAN003178000
- symbol: HMPREF1038_01726
- pan gene symbol?: yhbY
- synonym:
- product: conserved hypothetical RNA-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF1038_01726 [new locus tag: HMPREF1038_RS08475 ]
- symbol: HMPREF1038_01726
- product: conserved hypothetical RNA-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1594362..1594673
- length: 312
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: CP001845 (1594362..1594673) NCBI
- BioCyc: see HMPREF1038_RS08475
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1558 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTCATTAACATCAAAACAACGTGCCTTCCTCAACAGCCAGGCACACACCCTCAAACCT
ATCATCCAAATCGGGAAAAATGGACTCAACGACCAAATCAAAACCAGCGTCCGTCAAGCT
CTTGATGCGCGTGAATTAATCAAGGTTACTCTCTTACAAAACACAGATGAAAATATCCAC
GAAGTAGCTGAAATTTTGGAAGAAGAAATCGGTGTGGATACAGTCCAAAAAATAGGACGC
ATCTTGATTTTGTTTAAACAATCTAGCAAGAAAGAAAATCGCAAGATTTCTAAGAAAGTC
AAAGAAATCTAA60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF1038_01726 [new locus tag: HMPREF1038_RS08475 ]
- symbol: HMPREF1038_01726
- description: conserved hypothetical RNA-binding protein
- length: 103
- theoretical pI: 10.4432
- theoretical MW: 11704.5
- GRAVY: -0.437864
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General putative RNA-binding protein, YhbY family (TIGR00253; HMM-score: 86.8)
- TheSEED :
- RNA-binding protein YhbY
- PFAM: no clan defined CRS1_YhbY; CRS1 / YhbY (CRM) domain (PF01985; HMM-score: 74.8)and 4 moreGME (CL0197) PAD; Protein-arginine deiminase (PAD) (PF03068; HMM-score: 17.8)ACT (CL0070) NikR_C; NikR C terminal nickel binding domain (PF08753; HMM-score: 15.4)no clan defined CytochromB561_N; Cytochrome B561, N terminal (PF09786; HMM-score: 14.5)HTH (CL0123) Fe_dep_repr_C; Iron dependent repressor, metal binding and dimerisation domain (PF02742; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.93
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0
- Extracellular Score: 0.0695
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001337
- TAT(Tat/SPI): 0.000694
- LIPO(Sec/SPII): 0.000237
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: AFS43750 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSLTSKQRAFLNSQAHTLKPIIQIGKNGLNDQIKTSVRQALDARELIKVTLLQNTDENIHEVAEILEEEIGVDTVQKIGRILILFKQSSKKENRKISKKVKEI
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1558 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]