Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 02-AUG-2013
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae gamPNI0373
- locus tag: HMPREF1038_02163 [new locus tag: HMPREF1038_RS13685 ]
- pan locus tag?: PNEUPAN003838000
- symbol: HMPREF1038_02163
- pan gene symbol?: —
- synonym:
- product: IS861, transposase OrfA
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF1038_02163 [new locus tag: HMPREF1038_RS13685 ]
- symbol: HMPREF1038_02163
- product: IS861, transposase OrfA
- replicon: chromosome
- strand: +
- coordinates: 1975089..1975217
- length: 129
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001845 (1975089..1975217) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1980 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAATTGAATTATGAAGATAAAGTTCAGATCTATGAACTAAGAAAGCAAGGACAAAGC
TTCAAACAGCTTTCAAAAAGATTTGGTGTGGATGTTTCTGGTCTAAAGTCATCTGAATCT
TTGAGATGA60
120
129
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF1038_02163 [new locus tag: HMPREF1038_RS13685 ]
- symbol: HMPREF1038_02163
- description: IS861, transposase OrfA
- length: 42
- theoretical pI: 10.3875
- theoretical MW: 4921.61
- GRAVY: -0.878571
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination spore coat assembly protein SafA (TIGR02899; HMM-score: 14.4)RNA polymerase sigma factor, SigZ family (TIGR02959; HMM-score: 14.2)
- TheSEED :
- IS861, transposase (orf1), IS3 family, truncated
- PFAM: HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 24.3)and 4 moreno clan defined DUF2774; Protein of unknown function (DUF2774) (PF11242; HMM-score: 15.3)HTH (CL0123) HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 15.1)no clan defined QLQ; QLQ (PF08880; HMM-score: 14.8)HTH (CL0123) HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7947
- Cytoplasmic Membrane Score: 0.0023
- Cell wall & surface Score: 0.0018
- Extracellular Score: 0.2012
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.191235
- TAT(Tat/SPI): 0.009157
- LIPO(Sec/SPII): 0.020386
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: AFS44127 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLNYEDKVQIYELRKQGQSFKQLSKRFGVDVSGLKSSESLR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1980 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]