Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 22-NOV-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae gamPNI0373
- locus tag: HMPREF1038_RS07070 [old locus tag: HMPREF1038_01446 ]
- pan locus tag?: PNEUPAN002801000
- symbol: HMPREF1038_RS07070
- pan gene symbol?: ABC-NDB_3
- synonym:
- product: amino acid ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF1038_RS07070 [old locus tag: HMPREF1038_01446 ]
- symbol: HMPREF1038_RS07070
- product: amino acid ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1332249..1332992
- length: 744
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_018630 (1332249..1332992) NCBI
- BioCyc: HMPREF1038_RS07070 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1289 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGATTAAGATTTCGAATTTAAGCAAATCCTTTTCAGGACAGACTGTCTTGGATCATCTG
AACTTGGATATTCAAAAAGGGGAAGTTGTAGCCTTGATTGGTTCTTCAGGAGCTGGAAAA
TCAACCTTTCTTCGCAGTCTCAATTATCTTGAAACACCTGACAGTGGCTCTATTCAGATT
GATGGTTTTTCAGTTGATTTTTCTAAAATCACTCAAGAAGAAATCCTTGCCCTACGCCGT
AAGTTGTCTATGGTTTTCCAACAGTTTAATTTATTTGAACGTCGAACAGCACTTGATAAT
GTGAAAGAAGGCTTGGTTGTTGTCAAGAAATTATCTGACCAAGAAGCGACTAAGATTGCC
AAGGAAGAGTTGGCTAAGGTTGGGCTTTCGGACCGTGAAAACCATTATCCTCGCCATTTA
TCAGGTGGACAGAAGCAACGGGTTGCCCTAGCGCGTGCGCTTGCTATGAAACCAGATGTT
TTGCTCTTAGACGAACCAACTTCAGCCCTTGACCCAGAATTGGTCGGTGAAGTAGAAAAG
TCTATTGCAGATGCTGCTAAGTCAGGTCAGACCATGATTTTGGTCAGTCATGACATGTCC
TTTGTAGCCCAAGTTGCGGATAAAATTCTCTTCTTAGATAAGGGGAAAATCATCGAGTCT
GGAACTCCGGATGAGATTATCCACACCCCTAAAGAAGAGCGGACAAAAGAATTCTTCGCT
AGTTACAAACGGACTTATATTTGA60
120
180
240
300
360
420
480
540
600
660
720
744
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF1038_RS07070 [old locus tag: HMPREF1038_01446 ]
- symbol: HMPREF1038_RS07070
- description: amino acid ABC transporter ATP-binding protein
- length: 247
- theoretical pI: 6.69732
- theoretical MW: 27366.2
- GRAVY: -0.224696
⊟Function[edit | edit source]
- TIGRFAM: ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 258.9)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 218.1)and 73 moreTransport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 204.5)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 200.3)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 196.2)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 193.5)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 191.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 187.9)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 185.2)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 180.2)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 177.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 177)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 174.7)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 174.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 172.4)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 158.6)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 157.9)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 156.7)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 155.8)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 149.7)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 149.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 149.1)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 148)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 146.7)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 142.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 142.7)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 141.6)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 141.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 141.5)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 138.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 137.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 137.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 137.1)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 137.1)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 137)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 134.3)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 130.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 130.6)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 127.7)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 127.7)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 126.9)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 125.6)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 124.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 124.4)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 123.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 117.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 113)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 112)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 109.1)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 105.3)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 105.3)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 105.3)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 100.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 98.1)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 98.1)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 96.4)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 95.6)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 95.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 85.5)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 82.7)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 81.4)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 79.4)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 77.5)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 77.5)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 74.8)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 63.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 48.1)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 47.4)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 41.8)rad50 (TIGR00606; HMM-score: 17.6)P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 12.8)Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 12.5)KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 12.3)
- TheSEED: see HMPREF1038_01446
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 122.4)and 21 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 42.1)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 33.6)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.3)ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 21.1)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 20.5)AAA_22; AAA domain (PF13401; HMM-score: 19.6)AAA_16; AAA ATPase domain (PF13191; HMM-score: 17.8)AAA_23; AAA domain (PF13476; HMM-score: 17.5)AAA_33; AAA domain (PF13671; HMM-score: 16.6)AAA_15; AAA ATPase domain (PF13175; HMM-score: 15.4)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 14.9)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 14.5)AAA_25; AAA domain (PF13481; HMM-score: 14.3)AAA_24; AAA domain (PF13479; HMM-score: 13.6)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.5)no clan defined Neur_chan_memb; Neurotransmitter-gated ion-channel transmembrane region (PF02932; HMM-score: 13.3)P-loop_NTPase (CL0023) PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 12.6)NACHT; NACHT domain (PF05729; HMM-score: 12.4)FtsK_SpoIIIE; FtsK/SpoIIIE family (PF01580; HMM-score: 12)MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005111
- TAT(Tat/SPI): 0.001173
- LIPO(Sec/SPII): 0.000489
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000590986 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIKISNLSKSFSGQTVLDHLNLDIQKGEVVALIGSSGAGKSTFLRSLNYLETPDSGSIQIDGFSVDFSKITQEEILALRRKLSMVFQQFNLFERRTALDNVKEGLVVVKKLSDQEATKIAKEELAKVGLSDRENHYPRHLSGGQKQRVALARALAMKPDVLLLDEPTSALDPELVGEVEKSIADAAKSGQTMILVSHDMSFVAQVADKILFLDKGKIIESGTPDEIIHTPKEERTKEFFASYKRTYI
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1289 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.