Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 22-NOV-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae gamPNI0373
- locus tag: HMPREF1038_RS08510 [old locus tag: HMPREF1038_01734 ]
- pan locus tag?: PNEUPAN003247000
- symbol: HMPREF1038_RS08510
- pan gene symbol?: —
- synonym:
- product: MarR family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF1038_RS08510 [old locus tag: HMPREF1038_01734 ]
- symbol: HMPREF1038_RS08510
- product: MarR family transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 1600576..1600956
- length: 381
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_018630 (1600576..1600956) NCBI
- BioCyc: HMPREF1038_RS08510 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1565 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACCTATTTGGAAAAATGGTTTGACTTCAATCGGCGTCAGAAAGAAATTGAAAGTCTC
TTGGAAGAGACCATTGCCCAACAGAGCGAGCAAAGTCTGACCTTGAAAGAGTTCTACCTG
CTCTACTATCTGGACTTGGCTGAAGAAAAATCTCTACGCCAGATTGACCTGCCAGATAAG
CTTCATCTGAGCCCGAGCGCAGTTTCTAGGATGGTGGCTCGCTTGGAAGCTAAAAATTGC
GGTCTACTCAGTCGCATGTGTTGCCATCAAGATAGACGCTCTAGTTTTATCTGCCTGACA
AATGATGGGCAAAAGACACTGGCCTCGCTACAAAAGACTGTCGAAGAAAGCTTGGAAGCA
GGTTTGGATTTCTTGATTTAA60
120
180
240
300
360
381
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF1038_RS08510 [old locus tag: HMPREF1038_01734 ]
- symbol: HMPREF1038_RS08510
- description: MarR family transcriptional regulator
- length: 126
- theoretical pI: 4.98712
- theoretical MW: 14666.7
- GRAVY: -0.360317
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 34.9)homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 29.3)and 3 moreRegulatory functions DNA interactions D-serine deaminase transcriptional activator (TIGR02036; HMM-score: 14.3)mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 14.3)Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 12.6)
- TheSEED: see HMPREF1038_01734
- PFAM: HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 37.8)MarR_2; MarR family (PF12802; HMM-score: 33.1)and 4 moreHTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.3)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 18.3)HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 17.9)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 16.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9956
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0038
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001523
- TAT(Tat/SPI): 0.000342
- LIPO(Sec/SPII): 0.00027
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000221627 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTYLEKWFDFNRRQKEIESLLEETIAQQSEQSLTLKEFYLLYYLDLAEEKSLRQIDLPDKLHLSPSAVSRMVARLEAKNCGLLSRMCCHQDRRSSFICLTNDGQKTLASLQKTVEESLEAGLDFLI
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1565 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]