Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 22-NOV-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae gamPNI0373
- locus tag: HMPREF1038_RS10485 [old locus tag: HMPREF1038_02133 ]
- pan locus tag?: PNEUPAN003789000
- symbol: HMPREF1038_RS10485
- pan gene symbol?: —
- synonym:
- product: helix-turn-helix transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF1038_RS10485 [old locus tag: HMPREF1038_02133 ]
- symbol: HMPREF1038_RS10485
- product: helix-turn-helix transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 1941778..1941984
- length: 207
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_018630 (1941778..1941984) NCBI
- BioCyc: HMPREF1038_RS10485 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1947 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGCAACTAAAAAATCGTCTAAAAGAGCTTCGAGCTCGCGATGGTCTCAATCAAACCGAC
CTAGCCAAACTGGCAGGGGTTTCCAGACAGACCATTAGCCTACTAGAACGGGATGAGTAC
ACCCCATCCATTATCATTGCCCTGAAAATATCTCAAATTTTCAACGAAACAGTCGAATCG
GTATTTCGTTTGGAGGAGGACGAGTGA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF1038_RS10485 [old locus tag: HMPREF1038_02133 ]
- symbol: HMPREF1038_RS10485
- description: helix-turn-helix transcriptional regulator
- length: 68
- theoretical pI: 4.75628
- theoretical MW: 7847.91
- GRAVY: -0.401471
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 41.3)and 6 moreputative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 22.7)Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 18.9)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 18.9)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 18.9)Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 17.4)Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 16.1)
- TheSEED: see HMPREF1038_02133
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 53.1)and 19 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 36.9)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 35)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 26.2)LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 20.1)MarR_2; MarR family (PF12802; HMM-score: 18.4)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 17.4)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.4)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 15.9)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 15.4)Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 15)MarR; MarR family (PF01047; HMM-score: 14.9)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 14.9)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14.9)HTH_11; HTH domain (PF08279; HMM-score: 14.5)no clan defined DUF211; Uncharacterized ArCR, COG1888 (PF02680; HMM-score: 14.1)HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 13.9)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.8)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 13.6)no clan defined TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9809
- Cytoplasmic Membrane Score: 0.0026
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0162
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001278
- TAT(Tat/SPI): 0.000304
- LIPO(Sec/SPII): 0.000308
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001176227 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MQLKNRLKELRARDGLNQTDLAKLAGVSRQTISLLERDEYTPSIIIALKISQIFNETVESVFRLEEDE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1947 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]