Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 04-FEB-2016
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae INV104
- locus tag: INV104_17380 [new locus tag: INV104_RS10145 ]
- pan locus tag?: PNEUPAN003651000
- symbol: INV104_17380
- pan gene symbol?: —
- synonym:
- product: putative nucleotide-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: INV104_17380 [new locus tag: INV104_RS10145 ]
- symbol: INV104_17380
- product: putative nucleotide-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1906958..1907089
- length: 132
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312030 (1906958..1907089) NCBI
- BioCyc: see INV104_RS10145
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1828 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAAGTAGAAAATATTTCGTATAGGGTGGATCATCGTATATTGTTTGATAATATTTCT
TTTGATACTTCGAGTTCAGACGTGACATTAATTACTGGTAAAAATGGTACAGGAAAGTCA
ACTTTACTATAG60
120
132
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: INV104_17380 [new locus tag: INV104_RS10145 ]
- symbol: INV104_17380
- description: putative nucleotide-binding protein
- length: 43
- theoretical pI: 7.54121
- theoretical MW: 4774.35
- GRAVY: -0.218605
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 30.3)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 30.3)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 26)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 25.9)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 25.9)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 25.6)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 24.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 24.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 24.7)and 41 moreTransport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 23.3)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 22.3)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 20)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 19.9)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 19.8)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 19.4)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 19.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 19.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 19.1)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 18.8)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 18.7)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 17.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 17)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 16.7)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 16.6)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 16.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 16.3)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 16.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 16)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 15.8)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 15.5)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 15.5)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 15.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 15.4)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 14.2)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 13.8)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 13.6)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 13.6)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 13.6)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 13.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 13.2)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12.6)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.4)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.4)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 12.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 11.6)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 11.3)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 11.2)DNA metabolism Restriction/modification DNA sulfur modification protein DndD (TIGR03185; HMM-score: 11.1)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 10.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 10.3)
- TheSEED :
- ABC transporter, ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 29.2)AAA_23; AAA domain (PF13476; HMM-score: 27.8)ABC_tran; ABC transporter (PF00005; HMM-score: 26.9)and 13 moreAAA_27; AAA domain (PF13514; HMM-score: 17.6)AAA_15; AAA ATPase domain (PF13175; HMM-score: 16.5)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 16.2)AAA_30; AAA domain (PF13604; HMM-score: 14.9)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 14.8)AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.8)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.9)ATPase; KaiC (PF06745; HMM-score: 13.1)AAA_22; AAA domain (PF13401; HMM-score: 13.1)AAA_25; AAA domain (PF13481; HMM-score: 12.8)NACHT; NACHT domain (PF05729; HMM-score: 12.4)MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 11.8)ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7348
- Cytoplasmic Membrane Score: 0.1482
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.117
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.190761
- TAT(Tat/SPI): 0.010579
- LIPO(Sec/SPII): 0.013335
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CBW37419 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKVENISYRVDHRILFDNISFDTSSSDVTLITGKNGTGKSTLL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1828 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]