Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 02-OCT-2023
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BVJ1JL
- locus tag: JN057_00033 [new locus tag: JN057_RS00160 ]
- pan locus tag?: PNEUPAN000332000
- symbol: JN057_00033
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JN057_00033 [new locus tag: JN057_RS00160 ]
- symbol: JN057_00033
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 28426..28629
- length: 204
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP071871 (28426..28629) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGTAAAGAACTAAAAATAATTAAGGCTAAAATTAAAACTCGTTTGATTGAGTTGGAT
ATGACTCAAGTCGAATTGGCAAAACAAGTATCTGTAGCATCATCAGTTATTTCAGAGTTG
CTGAAGTATGGAAAAGGAAGTGATTATGTGAAAGAAAAAGTCGTAGATATTTTGGGTATT
GAAAACCCTTGGGAAAATAGTTAG60
120
180
204
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JN057_00033 [new locus tag: JN057_RS00160 ]
- symbol: JN057_00033
- description: hypothetical protein
- length: 67
- theoretical pI: 8.98347
- theoretical MW: 7535.81
- GRAVY: -0.135821
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 15.7)Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 14.5)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 14.5)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 14.5)
- TheSEED:
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 15.6)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 15.2)and 2 morePre-PUA (CL0668) DUF1947; Domain of unknown function (DUF1947) (PF09183; HMM-score: 12.4)no clan defined G-gamma; GGL domain (PF00631; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9776
- Cytoplasmic Membrane Score: 0.0022
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.02
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005736
- TAT(Tat/SPI): 0.000301
- LIPO(Sec/SPII): 0.000515
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: QTE31701 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSKELKIIKAKIKTRLIELDMTQVELAKQVSVASSVISELLKYGKGSDYVKEKVVDILGIENPWENS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]