Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 02-OCT-2023
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BVJ1JL
- locus tag: JN057_00598 [new locus tag: JN057_RS02895 ]
- pan locus tag?: PNEUPAN001479000
- symbol: JN057_00598
- pan gene symbol?: —
- synonym:
- product: IS30 family transposase ISSpn8
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JN057_00598 [new locus tag: JN057_RS02895 ]
- symbol: JN057_00598
- product: IS30 family transposase ISSpn8
- replicon: chromosome
- strand: +
- coordinates: 548782..549084
- length: 303
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP071871 (548782..549084) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0508 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCAAGACAATTATACTACAAAAGGTAAACATTTGACAATCGATAGCCGTCGCTTAATC
GAAAGATGGAAAAAAGAAGGAAAATCAAATAGAGAAGTTGCCTCTCTACTTGGAAAAGCT
CCTCAAACTATCCACACTGAAATCAAGCGTGGGACAGTCCGAAAATGTCTTGGAAAAGGG
CGCTTCAAAGAGGTTTATTCTGCCGACTACGCTCAACAGTCTTATGAAAACAATCGCAAG
CGCTCGGTCAAGAAATCAAGCTTGACCAAGGAACTAAAGGAAAAGATTCTCCACTATACA
TAA60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JN057_00598 [new locus tag: JN057_RS02895 ]
- symbol: JN057_00598
- description: IS30 family transposase ISSpn8
- length: 100
- theoretical pI: 10.7704
- theoretical MW: 11713.4
- GRAVY: -1.183
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 17.3)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 16)transcriptional regulator EpsA (TIGR03020; HMM-score: 15.3)and 1 moreAmino acid biosynthesis Aromatic amino acid family 3-deoxy-7-phosphoheptulonate synthase (TIGR01358; EC 2.5.1.54; HMM-score: 12.1)
- TheSEED: data available for Hungary19A-6
- PFAM: HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 59.3)and 4 moreSigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 17.6)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.4)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 13.4)GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9236
- Cytoplasmic Membrane Score: 0.0213
- Cell wall & surface Score: 0.0026
- Extracellular Score: 0.0525
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007744
- TAT(Tat/SPI): 0.002791
- LIPO(Sec/SPII): 0.001907
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: QTE32229 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MQDNYTTKGKHLTIDSRRLIERWKKEGKSNREVASLLGKAPQTIHTEIKRGTVRKCLGKGRFKEVYSADYAQQSYENNRKRSVKKSSLTKELKEKILHYT
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0508 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]