From PneumoWiki
Jump to navigation Jump to search
PangenomeTIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BM6001
serotype 19F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7465
serotype 1
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

NCBI: 02-OCT-2023

Summary[edit | edit source]

  • organism: Streptococcus pneumoniae BVJ1JL
  • locus tag: JN057_01519 [new locus tag: JN057_RS07380 ]
  • pan locus tag?: PNEUPAN002805000
  • symbol: JN057_01519
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JN057_01519 [new locus tag: JN057_RS07380 ]
  • symbol: JN057_01519
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1436851..1437468
  • length: 618
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: CP071871 (1436851..1437468) NCBI
  • BioCyc:
  • MicrobesOnline:
  • PneumoBrowse for strain D39V: SPV_1350 PneumoBrowse

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAACAAGAACGATTTCCATTGGTGTCAGATGACGAGGTCATGTTGACTGAAATGCCA
    GTCATGAATCTCTATGATGAGTCTGATCTGATCAGTAATATCAAGGGTGAGTATCGAGAT
    AAAAATTATTTAGAATGGGCTCCTATTGCTGAAGAAAAACCAGTAAAACCGATTGAAAAG
    CAAGTAGGGAAACCTAAAAAAGCTCCTTTAGGGGTTAAAAAAGAAGGAAAGAGCTATGCG
    GAGGTGGCGCGTGAAGAAGCGCGTGCAGACTTGAAAAAGAAACGCTCTGCTAACTATCTA
    ACTCAGGATTTCAGCCTTGCGAGACGTCATTCTCAGCCCAGTCTAGTTAGACAGGGCAAT
    CAACCGACAACTCCTTTCCAAAAGGAAAATCCTGGTGAATTTGTCAAATATAGCCAAAAA
    TTGACCCAGTCTCATTATATCTTGGCGGAAGAAGTTCATTCTATCCCTACCAAGAATGAA
    GAAGTGTCAGCACCTGCTCCAAAGAAAAACAATTATGATTTTCTAAAGAAGAGCCAAATC
    TACAATAAAAAAAGTAAACAAACAGAACAAGAACGTCGGGTTGCCCAAGAGTTGAATCTG
    ACCAGAATGACAGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    618

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JN057_01519 [new locus tag: JN057_RS07380 ]
  • symbol: JN057_01519
  • description: hypothetical protein
  • length: 205
  • theoretical pI: 9.76537
  • theoretical MW: 23771.8
  • GRAVY: -1.08341

Function[edit | edit source]

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8114
    • Cytoplasmic Membrane Score: 0.0831
    • Cell wall & surface Score: 0.0014
    • Extracellular Score: 0.1042
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00358
    • TAT(Tat/SPI): 0.000335
    • LIPO(Sec/SPII): 0.000452
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: QTE33099 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKQERFPLVSDDEVMLTEMPVMNLYDESDLISNIKGEYRDKNYLEWAPIAEEKPVKPIEKQVGKPKKAPLGVKKEGKSYAEVAREEARADLKKKRSANYLTQDFSLARRHSQPSLVRQGNQPTTPFQKENPGEFVKYSQKLTQSHYILAEEVHSIPTKNEEVSAPAPKKNNYDFLKKSQIYNKKSKQTEQERRVAQELNLTRMTE

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Expression data[edit | edit source]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]