From PneumoWiki
Jump to navigation Jump to search
PangenomeTIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BM6001
serotype 19F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7465
serotype 1
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

NCBI: 05-OCT-2017

Summary[edit | edit source]

  • organism: Streptococcus pneumoniae MDRSPN001
  • locus tag: MDRSPN_01242 [new locus tag: MDRSPN_RS06540 ]
  • pan locus tag?: PNEUPAN002804000
  • symbol: murC
  • pan gene symbol?: murC
  • synonym:
  • product: UDP-N-acetylmuramate--L-alanine ligase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: MDRSPN_01242 [new locus tag: MDRSPN_RS06540 ]
  • symbol: murC
  • product: UDP-N-acetylmuramate--L-alanine ligase
  • replicon: chromosome
  • strand: -
  • coordinates: 1258442..1259776
  • length: 1335
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: AP018391 (1258442..1259776) NCBI
  • BioCyc:
  • MicrobesOnline:
  • PneumoBrowse for strain D39V: SPV_1349 PneumoBrowse

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    ATGTCAAAGACATATCATTTTATCGGAATTAAGGGATCAGGGATGAGTGCCTTGGCCTTG
    ATGTTGCACCAGATGGGGCACAAGGTTCAGGGATCAGATGTTGAAAAGTACTACTTTACC
    CAACGCGGTCTTGAGCAGGCAGGAATTACCATTCTTCCTTTTGATGAAAAGAATCTAGAC
    GGTGATATGGAAATTATCGCTGGAAATGCCTTTCGTCCAGATAACAACGTCGAAATTGCC
    TATGCGGACCAAAATGGTATCAGCTACAAACGTTACCATGAGTTTCTAGGTAGCTTTATG
    CGTGACTTTGTTAGCATGGGAGTAGCAGGAGCACATGGAAAAACTTCAACGACAGGTATG
    TTGTCTCATGTCTTGTCTCACATTACAGATACCAGCTTCTTGATTGGAGATGGGACAGGT
    CGTGGTTCGGCTAATGCCAAATATTTTGTCTTTGAATCTGACGAATATGAGCGTCACTTC
    ATGCCTTACCACCCAGAATACTCTATTATCACCAACATTGACTTTGACCATCCAGATTAT
    TTCACAAGTCTCGAGGATGTTTTCAATGCCTTTAACGACTATGCCAAACAAATTACCAAG
    GGTCTTTTTGTCTATGGTGAAGATGCTGAATTGCGTAAGATTACGTCTGATGCACCAATT
    TATTATTATGGTTTTGAAGCTGAAGGCAATGACTTTGTAGCTAGTGATCTTCTTCGTTCA
    ACAACTGGTTCAACCTTCACCGTTCATTTCCGTGGACAAAACTTGGGGCAATTCCACATT
    CCAACCTTTGGTCGTCACAATATCATGAATGCGACAGCCGTTATTGGTCTTCTTTACACA
    GCAGGATTTGATTTGAACTTGGTGCGTGAGCACTTGAAAACATTTGCCGGTGTTAAACGT
    CGTTTCACTGAGAAAATTGTCAATGATACAGTGATTATTGATGACTTTGCCCATCATCCA
    ACAGAAATTATTGCGACCTTGGATGCGGCTCGTCAGAAATACCCAAGCAAGGAAATTGTA
    GCAGTCTTTCAACCGCATACCTTTACAAGAACCATTGCCCTGTTGGACGACTTTGCCCAT
    GCTTTAAACCAAGCAGATGCTGTTTATCTAGCGCAAATTTATGGCTCGGCTCGTGAAGTA
    GATCATGGTGACGTTAAGGTAGAAGACCTAGCCAATAAAATCAACAAAAAACACCAAGTG
    ATTACTGTTGAAAATGTTTCTCCACTCCTAGACCATGACAATGCTGTTTATGTCTTTATG
    GGAGCAGGAGACATCCAAACCTATGAATACTCATTTGAGCGTCTCTTGTCTAACTTGACA
    AGCAATGTTCAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1335

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: MDRSPN_01242 [new locus tag: MDRSPN_RS06540 ]
  • symbol: MurC
  • description: UDP-N-acetylmuramate--L-alanine ligase
  • length: 444
  • theoretical pI: 5.60518
  • theoretical MW: 49873.5
  • GRAVY: -0.240541

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylmuramate--L-alanine ligase (TIGR01082; EC 6.3.2.8; HMM-score: 407.9)
    and 6 more
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (TIGR01081; HMM-score: 191.1)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (TIGR01143; EC 6.3.2.10; HMM-score: 76.4)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylmuramyl-tripeptide synthetase (TIGR01085; HMM-score: 63.3)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylmuramoylalanine--D-glutamate ligase (TIGR01087; EC 6.3.2.9; HMM-score: 58.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Folic acid bifunctional protein FolC (TIGR01499; EC 6.3.2.-; HMM-score: 16.6)
    Cellular processes Cellular processes Biosynthesis of natural products cyanophycin synthetase (TIGR02068; EC 6.3.2.29,6.3.2.30; HMM-score: 11.2)
  • TheSEED: data available for D39, Hungary19A-6, TIGR4
  • PFAM:
    NADP_Rossmann (CL0063) Mur_ligase; Mur ligase family, catalytic domain (PF01225; HMM-score: 103)
    P-loop_NTPase (CL0023) Mur_ligase_M; Mur ligase middle domain (PF08245; HMM-score: 83.1)
    and 2 more
    no clan defined Mur_ligase_C; Mur ligase family, glutamate ligase domain (PF02875; HMM-score: 59.9)
    GBD (CL0202) CBM46; Carbohydrate binding domain (PF18448; HMM-score: 14.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9969
    • Cytoplasmic Membrane Score: 0.0003
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0026
  • SignalP: Signal peptide SP(Sec/SPI) length 31 aa
    • SP(Sec/SPI): 0.761431
    • TAT(Tat/SPI): 0.012787
    • LIPO(Sec/SPII): 0.006149
    • Cleavage Site: CS pos: 31-32. VQG-SD. Pr: 0.7245
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: BBA59441 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDVEKYYFTQRGLEQAGITILPFDEKNLDGDMEIIAGNAFRPDNNVEIAYADQNGISYKRYHEFLGSFMRDFVSMGVAGAHGKTSTTGMLSHVLSHITDTSFLIGDGTGRGSANAKYFVFESDEYERHFMPYHPEYSIITNIDFDHPDYFTSLEDVFNAFNDYAKQITKGLFVYGEDAELRKITSDAPIYYYGFEAEGNDFVASDLLRSTTGSTFTVHFRGQNLGQFHIPTFGRHNIMNATAVIGLLYTAGFDLNLVREHLKTFAGVKRRFTEKIVNDTVIIDDFAHHPTEIIATLDAARQKYPSKEIVAVFQPHTFTRTIALLDDFAHALNQADAVYLAQIYGSAREVDHGDVKVEDLANKINKKHQVITVENVSPLLDHDNAVYVFMGAGDIQTYEYSFERLLSNLTSNVQ

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Expression data[edit | edit source]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]