Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 17-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae MDRSPN001
- locus tag: MDRSPN_RS01490 [old locus tag: MDRSPN_00279 ]
- pan locus tag?: PNEUPAN001054000
- symbol: MDRSPN_RS01490
- pan gene symbol?: —
- synonym:
- product: SemiSWEET transporter
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: MDRSPN_RS01490 [old locus tag: MDRSPN_00279 ]
- symbol: MDRSPN_RS01490
- product: SemiSWEET transporter
- replicon: chromosome
- strand: +
- coordinates: 269045..269284
- length: 240
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_AP018391 (269045..269284) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0278 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATTGGAAGTATTGCAGCAATTTTAACAACATTTGCATTTTTACCACAAGTTTTTCGT
GTAGTTAAGACAAAGGACACAGGATCTATTGCTCTAGGTATGTATGTTATGCAAGTTATT
GGTATTGCATTGTGGCTTGCTCATGGTATTCGTATAGGAGACTTGCCTTTGATTTTAGCA
AATAGTGTTTCATTTCTACTCTCAGGAATAATTTTATTTTATAAATTGAAGTATAAATAA60
120
180
240
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: MDRSPN_RS01490 [old locus tag: MDRSPN_00279 ]
- symbol: MDRSPN_RS01490
- description: SemiSWEET transporter
- length: 79
- theoretical pI: 10.5438
- theoretical MW: 8642.51
- GRAVY: 1.08608
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for D39, TIGR4
- PFAM: MtN3-like (CL0141) PQ-loop; PQ loop repeat (PF04193; HMM-score: 35.7)MtN3_slv; Sugar efflux transporter for intercellular exchange (PF03083; HMM-score: 34.6)and 2 moreLAB_N; Lipid A Biosynthesis N-terminal domain (PF07578; HMM-score: 16.4)Transporter (CL0375) TMEM127; Transmembrane protein 127 (PF20517; HMM-score: 15.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9997
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017687
- TAT(Tat/SPI): 0.000186
- LIPO(Sec/SPII): 0.002827
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000580382 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIGSIAAILTTFAFLPQVFRVVKTKDTGSIALGMYVMQVIGIALWLAHGIRIGDLPLILANSVSFLLSGIILFYKLKYK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0278 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]