Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 10-NOV-2021
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ST556
- locus tag: MYY_RS12570
- pan locus tag?: PNEUPAN000938000
- symbol: MYY_RS12570
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: MYY_RS12570
- symbol: MYY_RS12570
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 264026..264166
- length: 141
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGGTGAAGCGAACTTGTGGCTACCTAGGTAATCCTCAAGCAAGACCGATGGTCAACGGG
CGTCACAAGGAAATCGCTGCGCGTGTCAAACATATGAATGGTTCAACGATTAAAATAGCT
GGGCATCAAGTAACAAATTAG60
120
141
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: MYY_RS12570
- symbol: MYY_RS12570
- description: hypothetical protein
- length: 46
- theoretical pI: 11.6641
- theoretical MW: 5071.92
- GRAVY: -0.6
⊟Function[edit | edit source]
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase (TIGR02487; EC 1.17.4.2; HMM-score: 15.4)
- TheSEED:
- PFAM: PFL-like (CL0339) NRDD; Anaerobic ribonucleoside-triphosphate reductase (PF13597; HMM-score: 20.2)and 1 morePeptidase_MD (CL0170) Peptidase_M15_2; Bacterial protein of unknown function (DUF882) (PF05951; HMM-score: 13.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.186287
- TAT(Tat/SPI): 0.009664
- LIPO(Sec/SPII): 0.030732
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001821483 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MVKRTCGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVTN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.