Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BM6001
- locus tag: ODS73_RS05605 [old locus tag: ODS73_05600 ]
- pan locus tag?: PNEUPAN002242000
- symbol: ODS73_RS05605
- pan gene symbol?: —
- synonym:
- product: YbaB/EbfC family nucleoid-associated protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: ODS73_RS05605 [old locus tag: ODS73_05600 ]
- symbol: ODS73_RS05605
- product: YbaB/EbfC family nucleoid-associated protein
- replicon: chromosome
- strand: -
- coordinates: 1081210..1081509
- length: 300
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP107038 (1081210..1081509) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0987 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGATGAACATGCAAAACATGATGCGTCAAGCACAAAAACTTCAAAAACAAATGGAACAA
AGCCAAGCTGAACTTGCTGCTATGCAATTTGTTGGCAAATCTGCTCAAGATCTTGTCCAA
GCGACCTTAACTGGCGATAAGAAAGTTGTCAGCATTGATTTCAATCCAGCTGTCGTTGAC
CCAGAGGACCTTGAGACTCTTTCTGATATGACCGTTCAAGCCATCAACTCTGCTCTTGAA
CAAATCGATGAAACTACCAAGAAAAAACTGGGTGCTTTCGCTGGGAAATTACCTTTCTAA60
120
180
240
300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ODS73_RS05605 [old locus tag: ODS73_05600 ]
- symbol: ODS73_RS05605
- description: YbaB/EbfC family nucleoid-associated protein
- length: 99
- theoretical pI: 4.54105
- theoretical MW: 10935.6
- GRAVY: -0.327273
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General DNA-binding protein, YbaB/EbfC family (TIGR00103; HMM-score: 78.4)and 3 moreCellular processes Adaptations to atypical conditions RNA polymerase sigma factor RpoS (TIGR02394; HMM-score: 12.4)Transcription Transcription factors RNA polymerase sigma factor RpoS (TIGR02394; HMM-score: 12.4)Transport and binding proteins Other efflux pump membrane protein (TIGR00998; HMM-score: 12.2)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: YbaB (CL0717) YbaB_DNA_bd; YbaB/EbfC DNA-binding family (PF02575; HMM-score: 89.5)and 9 moretRNA_bind_arm (CL0298) Val_tRNA-synt_C; Valyl tRNA synthetase tRNA binding arm (PF10458; HMM-score: 16.9)no clan defined SpoIVA_C; Sporulation stage IV protein A, C-terminal (PF20439; HMM-score: 16.9)CoA-acyltrans (CL0149) Condensation; Condensation domain (PF00668; HMM-score: 15.3)no clan defined Phage_GP20; Phage minor structural protein GP20 (PF06810; HMM-score: 13.2)Peptidase_CD (CL0093) Peptidase_C14; Caspase domain (PF00656; HMM-score: 12.5)no clan defined MctB; Copper transport outer membrane protein, MctB (PF11382; HMM-score: 12.5)TIM_barrel (CL0036) Dus; Dihydrouridine synthase (Dus) (PF01207; HMM-score: 11.4)RND_permease (CL0322) MMPL; MMPL family (PF03176; HMM-score: 10.2)HTH (CL0123) SKA1; Spindle and kinetochore-associated protein 1 (PF07160; HMM-score: 9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9906
- Cytoplasmic Membrane Score: 0.0022
- Cell wall & surface Score: 0
- Extracellular Score: 0.0073
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004924
- TAT(Tat/SPI): 0.002384
- LIPO(Sec/SPII): 0.000641
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000981526 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MMNMQNMMRQAQKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDMTVQAINSALEQIDETTKKKLGAFAGKLPF
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0987 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]