Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BM6001
- locus tag: ODS73_RS06220 [old locus tag: ODS73_06215 ]
- pan locus tag?: PNEUPAN002419000
- symbol: ODS73_RS06220
- pan gene symbol?: ptsH
- synonym:
- product: phosphocarrier protein HPr
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: ODS73_RS06220 [old locus tag: ODS73_06215 ]
- symbol: ODS73_RS06220
- product: phosphocarrier protein HPr
- replicon: chromosome
- strand: -
- coordinates: 1216289..1216552
- length: 264
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CP107038 (1216289..1216552) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1040 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCTTCTAAAGATTTCCACGTAGTGGCAGAAACAGGTATTCACGCACGTCCAGCAACA
TTGTTGGTACAAACTGCTAGCAAATTTGCTTCAGATATCACTCTTGAGTACAAAGGTAAA
TCAGTTAACCTTAAATCAATTATGGGTGTTATGAGTCTTGGTGTTGGTCAAGGTGCTGAC
GTAACTATCTCAGCTGAAGGTGCAGATGCAGATGACGCTATCGCTGCAATCTCAGAAACA
ATGGAAAAAGAAGGATTGGCATAA60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ODS73_RS06220 [old locus tag: ODS73_06215 ]
- symbol: ODS73_RS06220
- description: phosphocarrier protein HPr
- length: 87
- theoretical pI: 4.50093
- theoretical MW: 8939.1
- GRAVY: 0.162069
⊟Function[edit | edit source]
- TIGRFAM: Signal transduction PTS phosphocarrier, HPr family (TIGR01003; HMM-score: 109.6)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: no clan defined PTS-HPr; PTS HPr component phosphorylation site (PF00381; HMM-score: 103.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9979
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0
- Extracellular Score: 0.0015
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.020858
- TAT(Tat/SPI): 0.013242
- LIPO(Sec/SPII): 0.004625
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000146947 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MASKDFHVVAETGIHARPATLLVQTASKFASDITLEYKGKSVNLKSIMGVMSLGVGQGADVTISAEGADADDAIAAISETMEKEGLA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1040 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]