Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BM6001
- locus tag: ODS73_RS07970 [old locus tag: ODS73_07960 ]
- pan locus tag?: PNEUPAN000185000
- symbol: ODS73_RS07970
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: ODS73_RS07970 [old locus tag: ODS73_07960 ]
- symbol: ODS73_RS07970
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1558081..1558380
- length: 300
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP107038 (1558081..1558380) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGCCAATTGAAGAAGCTGAAAAAATCGCTCAAAGTCAGGTAGCTTGGGCGATTTTGTTT
ATCTTGCTTTTTTTTATTATCATTCGATATCTTATCAAGACTTCGGACAAGCGAGAGAAG
AAGATTATGGATTTGCACGAGCAATCAAAGGCCGACTCTAATAGACGAGAAGAGCGTTTG
ATGACTCACCTAGAAAAGACCACTACAGAATTAACCACAATCACTCACACGGTCGGAGAC
ATTCAAAAAGAAATGGTTCGCATGAACGACCGCATGGAAGAAATCGAAAAAGGAGAATAA60
120
180
240
300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ODS73_RS07970 [old locus tag: ODS73_07960 ]
- symbol: ODS73_RS07970
- description: hypothetical protein
- length: 99
- theoretical pI: 5.70961
- theoretical MW: 11763.6
- GRAVY: -0.525253
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions AmpG-like permease (TIGR00901; HMM-score: 12.6)and 2 moreProtein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 9)Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 7.5)
- TheSEED:
- PFAM: no clan defined Holin_BhlA; BhlA holin family (PF10960; HMM-score: 24.2)and 11 moreDUF6779; Domain of unknown function (DUF6779) (PF20570; HMM-score: 19)DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 17.5)DUF1043; Protein of unknown function (DUF1043) (PF06295; HMM-score: 16.1)DUF4446; Protein of unknown function (DUF4446) (PF14584; HMM-score: 16.1)RR_TM4-6; Ryanodine Receptor TM 4-6 (PF06459; HMM-score: 15.4)Uds1; Up-regulated During Septation (PF15456; HMM-score: 14.9)GPCR_A (CL0192) 7TM_GPCR_Srv; Serpentine type 7TM GPCR chemoreceptor Srv (PF10323; HMM-score: 14)OB (CL0021) NfeD; NfeD-like C-terminal, partner-binding (PF01957; HMM-score: 12.6)no clan defined DUF16; Protein of unknown function DUF16 (PF01519; HMM-score: 12.5)DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 9.7)GOLD-like (CL0521) EMP24_GP25L; emp24/gp25L/p24 family/GOLD (PF01105; HMM-score: 7.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.78
- Cytoplasmic Membrane Score: 8.16
- Cellwall Score: 0.06
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9958
- Cell wall & surface Score: 0
- Extracellular Score: 0.0042
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005835
- TAT(Tat/SPI): 0.00035
- LIPO(Sec/SPII): 0.001266
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001811580 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MPIEEAEKIAQSQVAWAILFILLFFIIIRYLIKTSDKREKKIMDLHEQSKADSNRREERLMTHLEKTTTELTTITHTVGDIQKEMVRMNDRMEEIEKGE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.