Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BM6001
- locus tag: ODS73_RS08245 [old locus tag: ODS73_08235 ]
- pan locus tag?: PNEUPAN002873000
- symbol: ODS73_RS08245
- pan gene symbol?: —
- synonym:
- product: helix-turn-helix transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: ODS73_RS08245 [old locus tag: ODS73_08235 ]
- symbol: ODS73_RS08245
- product: helix-turn-helix transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 1594090..1594305
- length: 216
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP107038 (1594090..1594305) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGCAGTGGACTTTAGAAGCTATGAGAATCAACAAAGGACTTACTCAAGCAGAGTTGGCA
GAAAAATTTGAAGTTTCAAGTCAAACAATTGCTAGATTAGAAAAAGATAGCTCTGATATC
GGTTATCAGCTATTGAAAAAATACATGTTTTTTTTCAATGTGAAATTCGATGATATTTTT
TTAGGGAAAAAATACGAAAATTTCGTAAATAACTAG60
120
180
216
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ODS73_RS08245 [old locus tag: ODS73_08235 ]
- symbol: ODS73_RS08245
- description: helix-turn-helix transcriptional regulator
- length: 71
- theoretical pI: 6.79625
- theoretical MW: 8422.62
- GRAVY: -0.398592
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 34.2)and 9 moreputative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 18.5)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.1)Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 13.9)Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.8)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.8)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.8)Cellular processes Sporulation and germination RNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.4)Transcription Transcription factors RNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.4)Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 11.9)
- TheSEED:
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 40.4)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 32.4)and 18 moreHTH_31; Helix-turn-helix domain (PF13560; HMM-score: 24.8)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 22.7)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 20.3)HTH_11; HTH domain (PF08279; HMM-score: 19.5)MarR_2; MarR family (PF12802; HMM-score: 19.3)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 19)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 18.2)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 16.5)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 14.4)HTH_psq; helix-turn-helix, Psq domain (PF05225; HMM-score: 14.2)Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 14.2)Trp_repressor; Trp repressor protein (PF01371; HMM-score: 13.3)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.2)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 13.1)MarR; MarR family (PF01047; HMM-score: 12.6)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 12.5)GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 12.1)HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8546
- Cytoplasmic Membrane Score: 0.0911
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.054
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003678
- TAT(Tat/SPI): 0.000333
- LIPO(Sec/SPII): 0.00074
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001198773 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MQWTLEAMRINKGLTQAELAEKFEVSSQTIARLEKDSSDIGYQLLKKYMFFFNVKFDDIFLGKKYENFVNN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]