Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BM6001
- locus tag: ODS73_RS11075 [old locus tag: ODS73_11065 ]
- pan locus tag?: PNEUPAN003716000
- symbol: relB
- pan gene symbol?: relB
- synonym:
- product: type II toxin-antitoxin system RelB family antitoxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: ODS73_RS11075 [old locus tag: ODS73_11065 ]
- symbol: relB
- product: type II toxin-antitoxin system RelB family antitoxin
- replicon: chromosome
- strand: +
- coordinates: 2102731..2102967
- length: 237
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP107038 (2102731..2102967) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATAATGTTGTTACTACACAAATTTCTATTCAACTTAGTCAAGAGTTAAATTCTTTA
TTAAATGCTATTGTTGAAGAAAATAATACAACAAAGACTGACTTTATTAGACAAGCTGTT
ATAGAGAAAATTGAAGATATGTATGATATTAAGGTCGCTGATGAAGCTTATAAAAAATGG
GGTGAATGTGGCAAAAAAGCTATCTCACATGAAGAAATGATGAGACGCTATGGCTAA60
120
180
237
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ODS73_RS11075 [old locus tag: ODS73_11065 ]
- symbol: RelB
- description: type II toxin-antitoxin system RelB family antitoxin
- length: 78
- theoretical pI: 4.7959
- theoretical MW: 9025.22
- GRAVY: -0.552564
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Plasmid functions plasmid transfer ATPase TraJ (TIGR02525; HMM-score: 13)
- TheSEED: data available for Hungary19A-6
- PFAM: Met_repress (CL0057) DUF6290; Family of unknown function (DUF6290) (PF19807; HMM-score: 66.2)and 5 moreRHH_1; Ribbon-helix-helix protein, copG family (PF01402; HMM-score: 22)KNTase_C (CL0291) NTase_sub_bind; Nucleotidyltransferase substrate binding protein like (PF08780; HMM-score: 13.7)no clan defined DUF3819; CCR4-Not complex, Not1 subunit, domain of unknown function DUF3819 (PF12842; HMM-score: 13.3)Met_repress (CL0057) TraY; TraY domain (PF05509; HMM-score: 12.9)ISOCOT_Fold (CL0246) IF-2B; Initiation factor 2 subunit family (PF01008; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9824
- Cytoplasmic Membrane Score: 0.0026
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0148
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017534
- TAT(Tat/SPI): 0.000404
- LIPO(Sec/SPII): 0.000944
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001067143 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNNVVTTQISIQLSQELNSLLNAIVEENNTTKTDFIRQAVIEKIEDMYDIKVADEAYKKWGECGKKAISHEEMMRRYG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]