Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BM6001
- locus tag: ODS73_RS12030
- pan locus tag?: PNEUPAN000776000
- symbol: ODS73_RS12030
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: ODS73_RS12030
- symbol: ODS73_RS12030
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 169657..169839
- length: 183
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP107038 (169657..169839) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTTCAATTAGGAGATAAAACCAGAATAATATTTGCCATTATAGGGGCAAGTTGCATA
TTAGTCAGTATGTATCTTATTCCACTTATTAAAACTGAGAATAAATTTTGGGAAATACTT
TTATTTATATTAGGTGTATTGCTAATTGGAATTGCGTTACTAAGTCAAAAAAATAAATTT
TGA60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ODS73_RS12030
- symbol: ODS73_RS12030
- description: hypothetical protein
- length: 60
- theoretical pI: 9.97033
- theoretical MW: 6813.39
- GRAVY: 1.12833
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 17.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids phosphoglycerate transporter family protein (TIGR00881; HMM-score: 14.9)and 2 morePEFG-CTERM domain (TIGR04296; HMM-score: 12.9)cxxc_20_cxxc protein (TIGR04104; HMM-score: 12.7)
- TheSEED:
- PFAM: no clan defined DUF2721; Protein of unknown function (DUF2721) (PF11026; HMM-score: 16.4)Hypoth_1 (CL0447) DUF3784; Domain of unknown function (DUF3784) (PF12650; HMM-score: 15.2)MFS (CL0015) MFS_1; Major Facilitator Superfamily (PF07690; HMM-score: 14.1)DoxD-like (CL0131) SURF4; SURF4 family (PF02077; HMM-score: 13.6)no clan defined DUF4491; Domain of unknown function (DUF4491) (PF14898; HMM-score: 13.4)SLATT (CL0676) SLATT_5; SMODS and SLOG-associating 2TM effector domain family 5 (PF18160; HMM-score: 13.3)and 1 moreno clan defined DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 9.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0004
- Cytoplasmic Membrane Score: 0.9493
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0502
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005413
- TAT(Tat/SPI): 0.000296
- LIPO(Sec/SPII): 0.209772
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000487107 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MFQLGDKTRIIFAIIGASCILVSMYLIPLIKTENKFWEILLFILGVLLIGIALLSQKNKF
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]