Jump to navigation
		Jump to search
		
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
⊟Summary[edit | edit source]
- pan ID?: PNEUPAN000843000
 - symbol?: —
 - synonym:
 - description?: AzlD domain-containing protein
- AzlD domain-containing protein
 - putative AzlD-like membrane transport protein
 - branched-chain amino acid transport protein AzlD
 - branched-chain amino acid permease
 - branched-chain amino acid transport protein
 - Branched-chain amino acid transport protein (AzlD)
 - conserved hypothetical protein
 - Predicted membrane protein
 - pseudogene
 
descriptions from strain specific annotations:
 - strand?: +
 - coordinates?: 1003618..79756
 - occurrence?: in 98% of 43 strains
 
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
| TIGR4 | |
| D39 | |
| D39V | |
| Hungary19A-6 | |
| EF3030 | 
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.505)
Hungary19A-6 MVSKYLLLAVIFSGLVTWILRMIPFILVKYKGLPAIVERFLKFLPVSIIFALILSSVVTG
EF3030 ---------------------------------------------------------MTG
:**
Hungary19A-6 KVGSLPQIKWLDFLAVFPTAWVAFRYRNLVGTVLFGVVLIAILRLVF
EF3030 KVGSLPQIKWLDFLAVFPTAWVAFRYRNLVGTVLFGVVLIAVLRLVF
*****************************************:*****