Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
⊟Summary[edit | edit source]
- pan ID?: PNEUPAN000975000
- symbol?: —
- synonym:
- description?: helix-turn-helix domain-containing protein
- helix-turn-helix domain-containing protein
- putative AraC-family transcriptional regulator
- transcriptional regulator, AraC family protein
- AraC family transcriptional regulator
- transcriptional regulator, AraC family
- conserved hypothetical protein
- helix-turn-helix domain protein
- Two-component response regulator, associated with ferric iron transporter, SPy1062 homolog
- pseudogene
descriptions from strain specific annotations:
- strand?: -
- coordinates?: 1140783..1142268
- occurrence?: in 70% of 43 strains
⊟Additional information (user-provided)[edit | edit source]
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
| D39 | |
| D39V | |
| EF3030 |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.505)
D39 MTLNEYILQYRLKQAIDKMAESPNSPLSAISDQVGFSDYKYFAKVFKKYLHISPKKLKSL
D39V MTLNEYILQYRLKQAIDKMAESPNSPLSAISDQVGFSDYKYFAKVFKKYLHISPKKLKSL
************************************************************
D39 GRIVK
D39V GRIVK
*****