Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 670-6B
- locus tag: SP670_0331 [new locus tag: SP670_RS01660 ]
- pan locus tag?: PNEUPAN000991000
- symbol: SP670_0331
- pan gene symbol?: —
- synonym:
- product: acetyltransferase, gnat family
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP670_0331 [new locus tag: SP670_RS01660 ]
- symbol: SP670_0331
- product: acetyltransferase, gnat family
- replicon: chromosome
- strand: +
- coordinates: 285336..285752
- length: 417
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP002176 (285336..285752) NCBI
- BioCyc: see SP670_RS01660
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0240 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATTACTATTAAAAAGCAAGAAATTGTCAAGCTAGAGGATGTTTTGCATCTCTATCAG
GCTGTCGGTTGGACAAATTATACCCATCAACCAGAGATGCTGGAGCATGCCTTATCGCAT
TCATTAGTAATTTATCTGGCACTTGATGGTGATGCTGTGGTGGGCTTGATTCGTTTGGTT
GGAGATGGATTCTCATCAGTTTTTGTACAGGATTTGATTGTTTTACCAATCTATCAGCGT
CAAGGGATTGGTAGTGCCCTAATGAAAGAGGCCTTAAAAGATTACAAAGATGCTTATCAA
GTCCAGCTGGTGACAGAAGAGACAGAAAAAAACGTGGGATTTTATCGTTCTATGGGCTTT
GAAATCTTATCCACCTATAATTGTATAGGGATGACTTGGGCGAATCGAGAAAAATAA60
120
180
240
300
360
417
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP670_0331 [new locus tag: SP670_RS01660 ]
- symbol: SP670_0331
- description: acetyltransferase, gnat family
- length: 138
- theoretical pI: 5.16575
- theoretical MW: 15702
- GRAVY: 0.0333333
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 32.2)and 2 moreBiosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs mycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 18.6)putative N-acetyltransferase, MSMEG_0567 N-terminal domain family (TIGR04045; HMM-score: 14.4)
- TheSEED :
- Acetyltransferase (EC 2.3.1.-) GNAT family
- PFAM: Acetyltrans (CL0257) Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 54.1)Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 51.2)and 5 moreAcetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 42.7)Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 23.6)Acetyltransf_15; Putative acetyl-transferase (PF17013; HMM-score: 17.9)PanZ; Acetyltransferase (GNAT) domain, PanZ (PF12568; HMM-score: 16.6)Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 16.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9688
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0
- Extracellular Score: 0.0296
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005507
- TAT(Tat/SPI): 0.000206
- LIPO(Sec/SPII): 0.000611
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADM90406 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MITIKKQEIVKLEDVLHLYQAVGWTNYTHQPEMLEHALSHSLVIYLALDGDAVVGLIRLVGDGFSSVFVQDLIVLPIYQRQGIGSALMKEALKDYKDAYQVQLVTEETEKNVGFYRSMGFEILSTYNCIGMTWANREK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0240 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]