Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 70585
- locus tag: SP70585_0823 [new locus tag: SP70585_RS04055 ]
- pan locus tag?: PNEUPAN001723000
- symbol: SP70585_0823
- pan gene symbol?: —
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP70585_0823 [new locus tag: SP70585_RS04055 ]
- symbol: SP70585_0823
- product: conserved hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 752579..752899
- length: 321
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000918 (752579..752899) NCBI
- BioCyc: see SP70585_RS04055
- MicrobesOnline: 7476770 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_0681 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAGACATAAATTCCAGCAAGTTCTAGATAAAATACATGATTTTTTAAATGGACATGAC
CAACCTGACCAGACTGAAACCAACTCCCTTACAGCCACTATTGAAGAGGCTATCCAGAAA
CAAACCGCTGTTCACCTTATCTTGTCTGAGACAAGCTTTACAGGTGATATCATCAAATAT
GATCAGCAAGGCCAGCAAATTATCGTGAAAAATTTTGCCAAAAATGTGAGCCGGATTATC
CGTATAAGCGATATTCAACGCCTGCGATTTGTCCCCTCAACTGTCCAAACAGCCCAAAAA
AATAGATTTAAGAAAGAGTGA60
120
180
240
300
321
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP70585_0823 [new locus tag: SP70585_RS04055 ]
- symbol: SP70585_0823
- description: conserved hypothetical protein
- length: 106
- theoretical pI: 10.103
- theoretical MW: 12306.9
- GRAVY: -0.632075
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination anti-sigma F factor antagonist (TIGR02886; HMM-score: 12.6)Regulatory functions Protein interactions anti-sigma F factor antagonist (TIGR02886; HMM-score: 12.6)
- TheSEED :
- FIG01114497: hypothetical protein
- PFAM: Beta_propeller (CL0186) DUF5711; Family of unknown function (DUF5711) (PF18975; HMM-score: 14.9)WYL (CL0654) YolD; YolD-like protein (PF08863; HMM-score: 13.7)Peptidase_CA (CL0125) UCH; Ubiquitin carboxyl-terminal hydrolase (PF00443; HMM-score: 12.3)and 1 moreGlyco_hydro_tim (CL0058) Raffinose_syn; Raffinose synthase or seed imbibition protein Sip1 (PF05691; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8713
- Cytoplasmic Membrane Score: 0.1216
- Cell wall & surface Score: 0.0026
- Extracellular Score: 0.0046
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004736
- TAT(Tat/SPI): 0.000676
- LIPO(Sec/SPII): 0.000451
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRHKFQQVLDKIHDFLNGHDQPDQTETNSLTATIEEAIQKQTAVHLILSETSFTGDIIKYDQQGQQIIVKNFAKNVSRIIRISDIQRLRFVPSTVQTAQKNRFKKE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0681 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]